Filtered Search Results
Product from some of our suppliers do not display in Filtered Search results. Please
clear all filters
to see these products
1
–
15
of
532,315
results

Novus Biologicals Tyrosine Hydroxylase Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 147 publications
Novus Biologicals NPLOC4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human,Mouse,Rat |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin) |
Isotype | IgG |
Antigen | NPLOC4 |
Gene Symbols | NPLOC4 |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Gene Alias | FLJ20657, FLJ23742, KIAA1499nuclear protein localization protein 4 homolog, NPL4Protein NPL4, nuclear protein localization 4 homolog (S. cerevisiae) |
Gene ID (Entrez) | 55666 |
Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:VRDECLLPCKDAPELGYAKESSSEQYVPDVFYKDVDKFGNEITQLARPLPVEYLIIDITTTFPKDPVYTFSISQNPFPIENRDVLGETQDFHSLATYLSQNTSSVFLDTISDFHLLLFLVTNE |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of human NPLOC4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Novus Biologicals BATF3 Antibody (841702) [DyLight 405], Novus Biologicals™
Mouse Monoclonal Antibody
Novus Biologicals Factor VIII Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 4 publications
Antigen | Factor VIII |
---|---|
Gene Symbols | F8 |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Target Species | Mouse,Rat |
Host Species | Rabbit |
Applications | Western Blot,Immunofluorescence,Immunohistochemistry (Paraffin) |
Immunogen | A synthetic peptide made to a C-terminal portion of human Factor VIII (between amino acids 2100-2250) [UniProt P00451] |
Novus Biologicals™ Multi-Species dsRNA ELISA Kit (Colorimetric)
ELISA kits are ideal for the quantification of target antigens in tissue extracts, serum and cell culture.
Target | Multi-Species |
---|---|
Specificity | The dsRNA Detection Kit allows sensitive and selective detection of dsRNA molecules (larger than 30-40 bp), independent of their nucleotide composition and sequence. |
Product Type | ELISA Kit (Colorimetric) |
Synonym | Double-stranded RNA |
Assay Sensitivity | 3 ng/ml |
Storage Requirements | Store at 4°C short term. Store at -20°C long term. Avoid freeze-thaw cycles. |
Assay Range | 1 - 300 ng/ml (0.1 - 30 ng/well) |
For Use With (Application) | ELISA |
Novus Biologicals Syndecan-2/CD362 Antibody (305515R), HRP, Novus Biologicals™
Rat Monoclonal Antibody
Novus Biologicals™ Recombinant Human alpha-Synuclein Aggregate Protein (Biologically Active)
Highly purified and high bioactivity. Generating reliable and reproducible results.
Conjugate | Unconjugated |
---|---|
Gene Symbol | SNCA |
For Use With (Application) | In vitro Assay,In vivo Assay,SDS-PAGE,Western Blot |
Source | E.Coli |
Name | Human alpha-Synuclein Aggregate Protein |
Regulatory Status | RUO |
Purification Method | >95% pure by SDS-PAGE |
Gene Alias | alpha-Synuclein, Lewy body 4, MGC110988, non A-beta component of AD amyloid, Non-A beta component of AD amyloid, non-A4 component of amyloid, Non-A4 component of amyloid precursor, PARK1, PARK4, synuclein, alpha (non A4 component of amyloid precursor) |
Product Type | Recombinant Protein |
Gene ID (Entrez) | 6622 |
Formulation | PBS |
Immunogen | MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA |
Cross Reactivity | Human |
Recombinant | Recombinant |
Novus Biologicals™ HGFR/c-MET Antibody (telisotuzumab) - Humanized, Novus Biologicals™
Human Monoclonal Antibody
Content And Storage | Store at -20°C in powder form. Store at -80°C once reconstituted. |
---|---|
Target Species | Human |
Host Species | Human |
Conjugate | Unconjugated |
Applications | Flow Cytometry,ELISA,Functional Assay |
Form | Purified |
Isotype | IgG1 |
Gene Accession No. | P08581 |
Research Discipline | Cancer, Cancer Stem Cells, Cell Cycle and Replication, Cellular Markers, Oncogenes, Phospho Specific, Protein Kinase, Signal Transduction, Tyrosine Kinases |
Antigen | HGFR/c-MET |
Regulatory Status | RUO |
Purification Method | Protein A purified |
Gene Alias | AUTS9, c-Met, EC 2.7.10, EC 2.7.10.1, hepatocyte growth factor receptor, HGF receptor, HGF/SF receptor, HGFR, Met (c-Met), met proto-oncogene (hepatocyte growth factor receptor), met proto-oncogene tyrosine kinase, oncogene MET, Proto-oncogene c-Met, RCCP2, Scatter factor receptor, SF receptor, Tyrosine-protein kinase Met |
Gene ID (Entrez) | 4233 |
Formulation | Lyophilized from 25mM histidine, 8% sucrose, 0.01% Tween80 (pH6.2) |
Immunogen | HGFR/ c-Met |
Classification | Monoclonal |
Reconstitution | Reconstitute with sterile, distilled water to a final concentration of 1 mg/mL. Gently shake to solubilize completely. Do not vortex. |
Primary or Secondary | Primary |
Clone | telisotuzumab |
Novus Biologicals Senataxin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 6 publications
Purity or Quality Grade | >95% by SDS-PAGE and HPLC |
---|---|
Molecular Weight (g/mol) | 26 kDa |
Gene Symbol | HMGB1 |
Endotoxin Concentration | Less than 1 EU/ug of HMGB1/HMG-1 as determined by LAL method. |
Storage Requirements | Store at -20°C to -70°C as supplied. After reconstitution, store at 2°C to 8°C for 1 month and at -20°C to -70°C for long term storage. Avoid repeated freeze-thaw cycles. |
Concentration | LYOPH |
For Use With (Application) | PAGE |
Protein | HMGB1/HMG-1 |
Accession Number | P09429, P09429, P09429 |
Gene Alias | Amphoterin, high mobility group box 1, High mobility group protein 1, high mobility group protein B1, high-mobility group (nonhistone chromosomal) protein 1, high-mobility group box 1, HMG-1, HMG1DKFZp686A04236, HMG3, SBP-1, Sulfoglucuronyl carbohydrate binding protein |
Gene ID (Entrez) | 3146 |
Formulation | Lyophilized from a 0.2 um filtered concentrated solution in PBS, pH 7.4. |
Research Category | Cellular Markers, Chromatin Research, Neuroscience |
Reconstitution | Recommended to centrifuge prior to opening. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0mg/mL. Apportion stock solutions into working aliquots and store at <-20°C. |
Novus Biologicals™ Leucine Aminopeptidase (LAP) Activity Assay Kit (Colorimetric)
Assay Kit (Colorimetric)
Novus Biologicals Npas4 Antibody (S408-79), Novus Biologicals™
Mouse Monoclonal Antibody has been used in 1 publication
Target Species | Human,Mouse,Rat |
---|---|
Host Species | Mouse |
Conjugate | Unconjugated |
Form | Purified |
Isotype | IgG1 |
Concentration | 1 mg/mL |
Antigen | Npas4 |
Gene Symbols | NPAS4 |
Regulatory Status | RUO |
Purification Method | Protein G purified |
Dilution | Western Blot 1:1000, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:100, Immunohistochemistry-Frozen |
Gene Alias | BHLHE79, bHLHe79neuronal PAS domain-containing protein 4, Class E basic helix-loop-helix protein 79, Le-PAS, neuronal PAS domain protein 4, Neuronal PAS4, NXFHLH-PAS transcription factor NXF, PASD10PAS domain-containing protein 10 |
Gene ID (Entrez) | 266743 |
Immunogen | Fusion protein amino acids 597-802 (C-terminus) of rat Npas4. |
Classification | Monoclonal |
Primary or Secondary | Primary |
Test Specificity | Detects 90kDa. |
Clone | S408-79 |