Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.
1
–
15
of
567,634
results

Novus Biologicals Factor VIII Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 4 publications
Antigen | Factor VIII |
---|---|
Gene Symbols | F8 |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Target Species | Mouse,Rat |
Host Species | Rabbit |
Applications | Western Blot,Immunofluorescence,Immunohistochemistry (Paraffin) |
Immunogen | A synthetic peptide made to a C-terminal portion of human Factor VIII (between amino acids 2100-2250) [UniProt P00451] |
Novus Biologicals NPLOC4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human,Mouse,Rat |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin) |
Isotype | IgG |
Antigen | NPLOC4 |
Gene Symbols | NPLOC4 |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Gene Alias | FLJ20657, FLJ23742, KIAA1499nuclear protein localization protein 4 homolog, NPL4Protein NPL4, nuclear protein localization 4 homolog (S. cerevisiae) |
Gene ID (Entrez) | 55666 |
Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:VRDECLLPCKDAPELGYAKESSSEQYVPDVFYKDVDKFGNEITQLARPLPVEYLIIDITTTFPKDPVYTFSISQNPFPIENRDVLGETQDFHSLATYLSQNTSSVFLDTISDFHLLLFLVTNE |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of human NPLOC4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Novus Biologicals PGC1 alpha Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 156 publications
Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human,Mouse,Rat,Pig,Goat,Hamster,Sheep,Squirrel |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot,ChIP Assay,Flow Cytometry,Immunohistochemistry,Immunocytochemistry,Immunoprecipitation |
Isotype | IgG |
Gene Accession No. | Q9UBK2 |
Research Discipline | Cancer, Cholesterol Metabolism, Chromatin Research, Diabetes Research, Lipid and Metabolism, mTOR Pathway, Neuroscience, Transcription Factors and Regulators |
Concentration | 1.0 mg/mL |
Antigen | PGC1 alpha |
Gene Symbols | PPARGC1A |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Dilution | Western Blot 1 - 2 ug/ml, Chromatin Immunoprecipitation reported by customer review, Flow Cytometry 1 - 2.5 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1:1000. Use reported in scientific literature (PMID 24508229), Immunoprecipitation reported in scientific literature (PMID 24769256), Immunohistochemistry-Paraffin 1:200, Immunohistochemistry-Frozen reported in scientific literature (PMID 25981953), Flow (Intracellular) 1 - 2.5 ug/ml, Chromatin Immunoprecipitation (ChIP), Knockout Validated, KnockDown Validated reported in scientific literature (PMID 35455432) |
Molecular Weight of Antigen | 91 kDa |
Gene Alias | LEM6, Ligand effect modulator 6, ligand effect modulator-6, L-PGC-1alpha, peroxisome proliferative activated receptor, gamma, coactivator 1, alpha, peroxisome proliferator-activated receptor gamma coactivator 1 alpha transcript variant B4-3ext, peroxisome proliferator-activated receptor gamma coactivator 1 alpha transcript variant B4-8a, peroxisome proliferator-activated receptor gamma coactivator 1 alpha transcript variant B5-NT, peroxisome proliferator-activated receptor gamma coactivator 1-alpha, peroxisome proliferator-activated receptor gamma, coactivator 1 alpha, PGC1, PGC-1(alpha), PGC1A, PGC-1-alpha, PGC1APGC-1(alpha), PGC1peroxisome proliferative activated receptor, gamma, coactivator 1, PGC-1v, PPAR gamma coactivator variant form, PPAR gamma coactivator-1, PPARgamma coactivator 1alpha, PPAR-gamma coactivator 1-alpha, PPARGC1, PPARGC-1-alpha |
Gene ID (Entrez) | 10891 |
Formulation | PBS with 0.02% Sodium Azide |
Immunogen | This PGC1 alpha Antibody was developed against a recombinant protein made to an internal portion of the human PGC-1 alpha protein (within residues 400-550). [Swiss-Prot# Q9UBK2]. |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Human and Mouse. Squirrel reactivity reported in the scientific literature. Expected reactivity based on sequence identity: monkey (98%), equine (94%), canine (93%) and rat (88%). Rat reactivity reported in scientific literature (PMID: 22208735). |
Novus Biologicals Tyrosine Hydroxylase Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 147 publications
Novus Biologicals BATF3 Antibody (841702) [DyLight 405], Novus Biologicals™
Mouse Monoclonal Antibody
Novus Biologicals EAAT1/GLAST-1/SLC1A3 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 18 publications
Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human,Mouse,Rat |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot,Flow Cytometry,ELISA,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin) |
Isotype | IgG |
Gene Accession No. | P24942 |
Research Discipline | Cellular Markers, Cognition and Behavior |
Concentration | 1.0 mg/mL |
Antigen | EAAT1/GLAST-1/SLC1A3 |
Gene Symbols | SLC1A3 |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Dilution | Western Blot 2 μg/mL, Flow Cytometry 1:200-1:500, ELISA 1:100 - 1:2000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1:10-1:500, Immunohistochemistry-Paraffin 1:50-1:500, Immunohistochemistry-Frozen 1:10-1:500, Flow (Intracellular) 1:500 |
Molecular Weight of Antigen | 60 kDa |
Gene Alias | EA6FLJ25094, EAAT1GLAST-1, excitatory amino acid transporter 1, GLAST, GLASTGLAST1, Sodium-dependent glutamate/aspartate transporter 1, solute carrier family 1 (glial high affinity glutamate transporter), member 3, Solute carrier family 1 member 3 |
Gene ID (Entrez) | 6507 |
Formulation | PBS with 0.02% Sodium Azide |
Immunogen | A synthetic peptide made to a C-terminal portion of the rat SLC1A3 protein (between residues 500-542) [Uniprot: P24942] |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Human, rat and mouse. Based upon 100% immunogen sequence similarity, this antibody is predicted to cross-react with Bovine also. |
Novus Biologicals LC3B Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 316 publications
Content And Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human,Mouse,Rat,Pig,Bacteria,Bovine,Canine,Primate,Zebrafish |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot,Flow Cytometry,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunoprecipitation,Immunohistochemistry (Paraffin),Immunohistochemistry (Frozen),Immunoblot,Immunoassay,Immunohistochemistry (Free Floating),KnockDown |
Isotype | IgG |
Gene Accession No. | Q9GZQ8 |
Research Discipline | Autophagy, Cancer, Cardiovascular Biology, Cellular Markers, Hypoxia, Innate Immunity, Lipid and Metabolism, Macroautophagy, Mitophagy, Neuroscience |
Concentration | 1.0 mg/mL |
Antigen | LC3B |
Gene Symbols | MAP1LC3B |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Dilution | Western Blot 1:1000, Simple Western 1:100, Flow Cytometry 1:200, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 0.1-2 ug/ml, Immunoprecipitation, Immunohistochemistry-Paraffin 1:200-1:400, Immunohistochemistry-Frozen 1:400, Immunoblotting, Electron Microscopy, Immunohistochemistry Free-Floating, Knockout Validated, Knockdown Validated |
Molecular Weight of Antigen | 14.688 kDa |
Gene Alias | ATG8F, Autophagy-related protein LC3 B, Autophagy-related ubiquitin-like modifier LC3 B, LC3B, lc3b autophagy marker, lc3-i, ii, MAP1 light chain 3-like protein 2, MAP1A/1BLC3, MAP1A/MAP1B LC3 B, map1lc3b, MAP1LC3B-a, microtubule associated protein 1 light chain 3 beta, microtubule associated protein 3 b, microtubule associated protein 3 beta, microtubule-associated proteins 1A/1B light chain 3, microtubule-associated proteins 1A/1B light chain 3B |
Gene ID (Entrez) | 81631 |
Formulation | PBS with 0.02% Sodium Azide |
Immunogen | Polyclonal LC3B Antibody was made to a synthetic peptide made to the N-terminal region of the human LC3B protein. [Uniprot: Q9GZQ8] |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Human, mouse, rat and bovine. Zebrafish reactivity reported in scientific literature (PMID: 23724125). Canine and primate reactivity reported in scientific literature (PMID: 24027311) Porcine reactivity reported in scientific literature (PMID: 25378587) Other species have not been tested. |
Novus Biologicals Tyrosine Hydroxylase, p Ser40 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 6 publications
Novus Biologicals Goat anti-Llama IgG (H+L) Secondary Antibody, HRP, Novus Biologicals™
Goat Polyclonal Antibody has been used in 9 publications