accessibility menu, dialog, popup

UserName
Bio Techne logo

Bio Techne

Bio-Techne is a global developer, manufacturer, and supplier of high-quality reagents, analytical instruments, and precision diagnostics. Whether you’re at the cutting edge of academic research, translating basic discoveries into therapeutic leads, or at a facility that requires the highest level of diagnostic testing, our award-winning tools and solutions empower scientists and clinicians to achieve reproducible and consistent results. Choosing Bio‑Techne means having confidence that every solution you use will help move you towards better answers.

Top Categories

Antibodies

Antibodies are essential tools for biomedical research as they allow researchers to identify specific proteins or molecules. Our catalog of over 425,000 antibodies from our R&D Systems™ and Novus Biologicals™ brands have been validated for specificity and reproducibility in over 25 species for more than 15 applications, ensuring that you will find one for your research needs.

Find Your Antibodies
Antibodies

Cell Culture Reagents and Assays

Your unique cell cultures require a consistent foundation whether you are using classical or specialty media, sera, supplements, and matrices. Thorough cell characterization is also critical to determine if the phenotype is what you need for your particular application.

Find Your Cell Culture Reagents
Cell Culture Reagents and Assays

ELISA Kits

Have confidence in your results with R&D Systems™ rigorously validated and tested ELISA kits. As the most published ELISA supplier, with more than 30 years of experience designing and optimizing quantitative immunoassays, you can trust that you have publishable, reproducible data every time.

Find Your ELISA Kits
ELISA Kits

Fluorescent Dyes and Probes

Fluorescent and bioluminescent reagents enable highly sensitive and selective visualization of biological events, from single molecule tracking in vitro through to in vivo imaging. Discover our exclusive range of fluorescent probes, indicators, dyes, and stains.

Find Your Dyes and Probes
Fluorescent Dyes and Probes

Recombinant Proteins

Bio-Techne offers over 5,000 R&D Systems™ bioactive recombinant proteins spanning 35 species and multiple research areas. Our portfolio includes cytokines and growth factors, proteins for studying immuno-oncology targets, enzymes, and animal-free and GMP-grade proteins, as well as custom protein development services and more.

Find Your Recombinant Proteins
Recombinant Proteins

Small Molecules and Peptides

Small molecules and peptides can be used in all stages of biological and biomedical research. Bio-Techne’s unique collection of small molecules and peptides includes high quality, novel, and innovative compounds such as enzyme inhibitors, ion channel modulators, GPCR agonists and antagonists, fluorescent probes and dyes, and molecular biology tools.

Find Your Small Molecules
Small Molecules and Peptides

Related Resources

Optimizing Organoid Culture Conditions:

Optimizing Organoid Culture Conditions

An application note demonstrating the value of R&D Systems™ proteins for achieving robust, reproducible organoid culture conditions
Filename
23227_bio_techne_optimizing_organoids_Fisherised_v2.pdf
Size
1 MB
Format
application/pdf
Realize Your Protein and Cell Potential

Realize Your Protein and Cell Potential

Realize your protein and cell potential
Filename
23227_bio_techne_realize_protein_Fisherised.pdf
Size
3 MB
Format
application/pdf
Organ-on-a-Chip Technology:

Organ-on-a-Chip Technology

Progress, challenges, and an exciting future
Filename
23227_bio_techne_organ_on_a_chip_technology_progress_Fisherised.pdf
Size
326 KB
Format
application/pdf

Fisher Scientific Europe Announces a New Distribution Agreement with Bio-Techne in Europe

Paris, France 01-05-2024

 

Thermo Fisher Scientific, a leading provider of laboratory products and services, is pleased to announce a significant milestone in its commitment to providing cutting-edge solutions to its customers. Effective May 1, 2024, Thermo Fisher will enter into a strategic European distribution agreement with Bio-Techne (NASDAQ: TECH), a global life sciences company providing innovative tools and bioactive reagents for the research and clinical diagnostic communities.

This partnership marks an important collaboration between two industry leaders in the fields of scientific research, diagnostics, and biotechnology. Under this agreement, Thermo Fisher, through the Fisher Scientific channel, Europe, will distribute Bio-Techne's extensive portfolio of innovative products, including antibodies, proteins, immunoassay kits, reagents and enzymes to laboratories and research institutions across Europe.

"We are thrilled to forge this partnership with Bio-Techne, a company renowned for its pioneering advancements in the life sciences industry," said Claire Wallace, President, Fisher Scientific channel, Europe. "By adding Bio-Techne's high-quality products to our comprehensive portfolio, we aim to further empower scientists and researchers with the tools they need to drive breakthrough discoveries and advancements in healthcare."

Bio-Techne's state-of-the-art products are designed to accelerate research and improve outcomes in areas including cell and gene therapy, immunology, neuroscience, and more. With this collaboration, Thermo Fisher reinforces its commitment to providing customers with access to the latest technologies and expertise, ultimately advancing scientific knowledge and improving human health.

"We are excited to partner with Thermo Fisher to expand the reach of our products and services throughout Europe," said Kim Kelderman, Bio-Techne’s President and Chief Executive Officer. "By leveraging the Fisher Scientific Channel's extensive European distribution network and industry expertise, we aim to enhance support for researchers and accelerate scientific discoveries that address some of the most pressing challenges in healthcare today."

This distribution agreement underscores Thermo Fisher's dedication to fostering innovation and collaboration within the scientific community. Through strategic partnerships with leading companies like Bio-Techne, Thermo Fisher continues to strengthen its position as a trusted partner for researchers and laboratories across Europe.

About Bio-Techne

Bio-Techne Corporation (NASDAQ: TECH) is a global life sciences company providing innovative tools and bioactive reagents for the research and clinical diagnostic communities. Bio-Techne products assist scientific investigations into biological processes and the nature and progress of specific diseases. They aid in drug discovery efforts and provide the means for accurate clinical tests and diagnoses. With thousands of products in its portfolio, Bio-Techne generated over $1.1 billion in net sales in fiscal year 2023 and has approximately 3,100 employees worldwide.

 

Questions? Reach Out to a Specialist >

 

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Narrow Results

category

special programs

  • (191)

Applications

  • (64)
  • (133)
  • (112)
  • (7)
  • (1)
  • (464)
  • (106)
  • (5)
  • (1,593)
  • (298)
  • (1,323)
  • (1)
  • (51)
  • (69)
  • (4)
  • (127)
  • (40,407)
  • (1)
  • (36)
  • (104)
  • (93)
  • (1,157)
  • (343)
  • (204,662)
  • (4,963)
  • (4,852)
  • (4,900)
  • (21)
  • (59)
  • (99,939)
  • (290)
  • (7,614)
  • (3)
  • (6)
  • (309)
  • (6,946)
  • (6)
  • (12)
  • (92)
  • (3,860)
  • (63)
  • (67)
  • (6)
  • (36)
  • (1,223)
  • (857)
  • (57,133)
  • (51,891)
  • (325)
  • (28)
  • (68,051)
  • (204,803)
  • (425)
  • (9,346)
  • (24)
  • (178,929)
  • (18)
  • (48)
  • (277)
  • (36,904)
  • (52)
  • (175)
  • (23)
  • (146)
  • (86)
  • (127)
  • (5,074)
  • (89)
  • (8)
  • (6)
  • (134)
  • (5)
  • (129)
  • (967)
  • (2)
  • (9,539)
  • (18)
  • (279)
  • (93)
  • (6,989)
  • (309)
  • (2)
  • (3)
  • (383)
  • (3)
  • (7)
  • (127)
  • (4,300)
  • (135)
  • (142)
  • (2,628)
  • (75)
  • (1)
  • (22)
  • (100)
  • (11)
  • (366,660)
  • (453)
  • (15)

Classification

  • (294,754)
  • (272,217)

Target Species

  • (6)
  • (27)
  • (104)
  • (583)
  • (110)
  • (13)
  • (292)
  • (17)
  • (21)
  • (316)
  • (417)
  • (24)
  • (1,640)
  • (154)
  • (7,250)
  • (356)
  • (1,292)
  • (98)
  • (22)
  • (165)
  • (5)
  • (6)
  • (6,929)
  • (296)
  • (2,539)
  • (136)
  • (251)
  • (262)
  • (141)
  • (2)
  • (1)
  • (919)
  • (157)
  • (25)
  • (17)
  • (615)
  • (50)
  • (7)
  • (551)
  • (74)
  • (1)
  • (1,740)
  • (39)
  • (1)
  • (1,548)
  • (29)
  • (292)
  • (127)
  • (1)
  • (49)
  • (396)
  • (72)
  • (49)
  • (821)
  • (1)
  • (97)
  • (8)
  • (1,104)
  • (37)
  • (180)
  • (71)
  • (53)
  • (35)
  • (55)
  • (1,147)
  • (107)
  • (507,335)
  • (346)
  • (31)
  • (50)
  • (7)
  • (38)
  • (388)
  • (167)
  • (187)
  • (12)
  • (33)
  • (10)
  • (69)
  • (163)
  • (723)
  • (343)
  • (2)
  • (12)
  • (67)
  • (3,811)
  • (34)
  • (2)
  • (205,711)
  • (1,965)
  • (2)
  • (147)
  • (8)
  • (21)
  • (1,693)
  • (1)
  • (2)
  • (116)
  • (30)
  • (43)
  • (15)
  • (42)
  • (6,102)
  • (24)
  • (238)
  • (8)
  • (195)
  • (4,677)
  • (39)
  • (175)
  • (1)
  • (3,022)
  • (175)
  • (138,286)
  • (2,128)
  • (113)
  • (63)
  • (20)
  • (4)
  • (111)
  • (24)
  • (4)
  • (493)
  • (653)
  • (1,211)
  • (76)
  • (2)
  • (16)
  • (12)
  • (60)
  • (522)
  • (21)
  • (2)
  • (994)
  • (8,512)
  • (78)
  • (898)
  • (481)
  • (821)

Conjugate

  • (3)
  • (16,305)
  • (4)
  • (1,597)
  • (4)
  • (4)
  • (1)
  • (11,813)
  • (12,710)
  • (12,740)
  • (13,124)
  • (11,812)
  • (12,776)
  • (12,709)
  • (11,819)
  • (4)
  • (92)
  • (2)
  • (3)
  • (2)
  • (3)
  • (3)
  • (17,743)
  • (14,121)
  • (3)
  • (3)
  • (2)
  • (1)
  • (1)
  • (17,534)
  • (17,562)
  • (17,356)
  • (11)
  • (17,494)
  • (21,105)
  • (9)
  • (11)
  • (17,486)
  • (17,869)
  • (17,893)
  • (10)
  • (17,089)
  • (4)
  • (2)
  • (17,876)
  • (1)
  • (1)
  • (9,225)
  • (18,702)
  • (1,696)
  • (1,695)
  • (18,642)
  • (9,180)
  • (1)
  • (16,257)
  • (1,599)
  • (1,605)
  • (1,657)
  • (4)
  • (4)
  • (3)
  • (4)
  • (18,183)
  • (2)
  • (4)
  • (6)
  • (11)
  • (2)
  • (16)
  • (11)
  • (86,187)
  • (2)
  • (17,805)
  • (17,747)
  • (17,748)

Quantity

  • (2)
  • (1)
  • (3,043)
  • (93)
  • (1,770)
  • (2,282)
  • (1)
  • (1)
  • (1)
  • (612)
  • (2,932)
  • (452,744)
  • (10,137)
  • (8)
  • (729)
  • (47)
  • (3)
  • (1)
  • (3,130)
  • (371)
  • (914)
  • (43)
  • (1)
  • (1)
  • (1)
  • (5,969)
  • (267)
  • (1)
  • (3)
  • (3)
  • (7)
  • (24)
  • (1)
  • (1,759)
  • (1,189)
  • (2)
  • (4)
  • (1)
  • (17)
  • (1)
  • (30)
  • (3)
  • (82)
  • (7,497)
  • (37,433)
  • (1)
  • (11)
  • (1)
  • (1)
  • (7)
  • (5)
  • (6)
  • (1)
  • (4)
  • (1)
  • (1)
  • (4)
  • (1)
  • (1)
  • (4)
  • (13)
  • (83)
  • (2,089)
  • (1,556)
  • (4)
  • (64)
  • (3)
  • (46)
  • (1)
  • (16,799)
  • (969)
  • (1)
  • (7)
  • (11)
  • (25)
  • (1)
  • (2,135)
  • (2)
  • (198)
  • (1)
  • (4)
  • (1)
  • (1)
  • (4)
  • (7)
  • (525)
  • (7)
  • (1)
  • (4)
  • (725)
  • (6,692)
  • (3)
  • (2)
  • (7)
  • (15)
  • (601)
  • (1)
  • (2)
  • (3)
  • (5)
  • (3)
  • (1)
  • (256)
  • (5)
  • (7)

Host Species

  • (331)
  • (15)
  • (1,279)
  • (466)
  • (3)
  • (20,990)
  • (7)
  • (24)
  • (348)
  • (7,506)
  • (8)
  • (23)
  • (217,713)
  • (5)
  • (279,324)
  • (22,351)
  • (15,357)
  • (1)
  • (1)

Isotype

  • (41)
  • (31)
  • (3)
  • (1)
  • (27)
  • (2)
  • (309,344)
  • (16,810)
  • (215)
  • (90,643)
  • (35,874)
  • (382)
  • (7)
  • (15)
  • (2,643)
  • (132)
  • (1,829)
  • (76)
  • (39,395)
  • (11,297)
  • (225)
  • (2)
  • (38,966)
  • (10,945)
  • (233)
  • (2)
  • (5)
  • (374)
  • (1,409)
  • (25)
  • (1,231)
  • (721)
  • (6)
  • (906)
  • (59)
  • (7)
  • (195)
  • (58)
  • (6)
  • (989)
  • (17)

Regulatory Status

  • (563,685)

Form

  • (406)
  • (472)
  • (4)
  • (4,028)
  • (435)
  • (58)
  • (532,168)
  • (444)

For Use With (Application)

  • (2,098)
  • (1,802)
  • (7)
  • (1)
  • (16)
  • (305)
  • (19,688)
  • (2)
  • (4)
  • (16)
  • (34)
  • (78)
  • (1)
  • (7)
  • (7)
  • (3)
  • (10)
  • (546)
  • (19,634)
  • (3)
  • (19)
  • (20)
  • (41)
  • (235)
  • (562)
  • (9)
  • (322)
  • (8)
  • (57)
  • (73)
  • (27)
  • (1)
  • (68)
  • (1)
  • (11)
  • (4,194)
  • (2)
  • (19,542)
  • (6)
  • (2,372)
  • (4)
  • (2)
  • (2)
  • (1)
  • (2)
  • (1)
  • (19,727)
  • (5)
  • (1)

1 – 15 of 665,167 results
2

HGFR/c-MET Antibody (telisotuzumab) - Humanized, Novus Biologicals™

Human Monoclonal Antibody

Content And Storage Store at -20°C in powder form. Store at -80°C once reconstituted.
Target Species Human
Host Species Human
Conjugate Unconjugated
Applications Flow Cytometry,ELISA,Functional Assay
Form Purified
Isotype IgG1
Gene Accession No. P08581
Research Discipline Cancer, Cancer Stem Cells, Cell Cycle and Replication, Cellular Markers, Oncogenes, Phospho Specific, Protein Kinase, Signal Transduction, Tyrosine Kinases
Antigen HGFR/c-MET
Regulatory Status RUO
Purification Method Protein A purified
Gene Alias AUTS9, c-Met, EC 2.7.10, EC 2.7.10.1, hepatocyte growth factor receptor, HGF receptor, HGF/SF receptor, HGFR, Met (c-Met), met proto-oncogene (hepatocyte growth factor receptor), met proto-oncogene tyrosine kinase, oncogene MET, Proto-oncogene c-Met, RCCP2, Scatter factor receptor, SF receptor, Tyrosine-protein kinase Met
Gene ID (Entrez) 4233
Formulation Lyophilized from 25mM histidine, 8% sucrose, 0.01% Tween80 (pH6.2)
Immunogen HGFR/ c-Met
Classification Monoclonal
Reconstitution Reconstitute with sterile, distilled water to a final concentration of 1 mg/mL. Gently shake to solubilize completely. Do not vortex.
Primary or Secondary Primary
Clone telisotuzumab
6

GAD2/GAD65 Antibody (U.Washington patent anti-GAD65), Novus Biologicals™

Human Monoclonal Antibody

Content And Storage Store at -20°C in powder form. Store at -80°C once reconstituted.
Target Species Human
Host Species Human
Conjugate Unconjugated
Applications Flow Cytometry,ELISA,Functional Assay
Form Purified
Isotype IgG1
Gene Accession No. Q05329
Research Discipline Diabetes Research, Immune System Diseases, Immunology, Lipid and Metabolism, Neuronal Cell Markers, Neuroscience
Antigen GAD2/GAD65
Regulatory Status RUO
Purification Method Protein A purified
Gene Alias EC 4.1.1, EC 4.1.1.15, GAD-65, GAD65MGC161605, glutamate decarboxylase 2, glutamate decarboxylase 2 (pancreatic islets and brain, 65kD), glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa), Glutamate decarboxylase 65 kDa isoform, Glutamate decarboxylase-2 (pancreas), MGC161607,65 kDa glutamic acid decarboxylase
Gene ID (Entrez) 2572
Formulation Lyophilized from 25mM histidine, 8% sucrose, 0.01% Tween80 (pH6.2)
Immunogen GAD65
Classification Monoclonal
Reconstitution Reconstitute with sterile, distilled water to a final concentration of 1 mg/mL. Gently shake to solubilize completely. Do not vortex.
Primary or Secondary Primary
Clone U.Washington patent anti-GAD65
9

AHR Antibody (RPT9) - BSA Free, Novus Biologicals™

Mouse Monoclonal Antibody has been used in 7 publications

10

HIF-1 alpha, Hydroxy Pro564 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 6 publications

14

TEM7/PLXDC1 Antibody (197C193 (IM193)) - BSA Free, Novus Biologicals™

Mouse Monoclonal Antibody has been used in 8 publications

Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Target Species Human,Mouse,Rat
Host Species Mouse
Conjugate Unconjugated
Applications Western Blot,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunoprecipitation,Immunohistochemistry (Paraffin)
Form Purified
Isotype IgG1
Gene Accession No. Q8IUK5
Research Discipline Angiogenesis
Concentration 1.0 mg/ml
Antigen TEM7/PLXDC1
Gene Symbols PLXDC1
Regulatory Status RUO
Purification Method Protein G purified
Dilution Western Blot, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1:10-1:500. Use reported in scientific literature (Meng et al (2007)), Immunoprecipitation 1:10-1:500. Use reported in scientific literature (Nanda et al (2004)), Immunohistochemistry-Paraffin 2-5 ug/ml, Immunohistochemistry-Frozen reported in scientific literature (Lee et al (2006))
Gene Alias FLJ45632, plexin domain containing 1,2410003I07Rik, plexin domain-containing protein 1, TEM3FLJ36270, TEM7DKFZp686F0937, Tumor endothelial marker 3, Tumor endothelial marker 7
Gene ID (Entrez) 57125
Immunogen Amino acids 409-425 (LQNNLSPKTKGTPVHLG) of human TEM7 were used to develop this monoclonal antibody.
Classification Monoclonal
Primary or Secondary Primary
Clone 197C193 (IM193)
15

Follistatin-like 1/FSTL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin)
Isotype IgG
Research Discipline Cardiovascular Biology
Antigen Follistatin-like 1/FSTL1
Gene Symbols FSTL1
Regulatory Status RUO
Purification Method Affinity Purified
Dilution Western Blot 0.04 - 0.4 μg/mL, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:50-1:200
Gene Alias FLJ50214, follistatin-like 1, Follistatin-like protein 1, follistatin-related protein 1, FRPFLJ52277, FSL1
Gene ID (Entrez) 11167
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:NFDNGDSRLDSSEFLKFVEQNETAINITTYPDQENNKLLRGLCVDALIELSDENADWKLSFQEFLKCLNPSFNPPE
Classification Polyclonal
Primary or Secondary Primary
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Bio Techne