Bio Techne

Narrow Results

special programs

Encompass (452)

Classification

Monoclonal (226,438)
Polyclonal (179,909)

Regulatory Status

RUO (404,423)

Form

Antisera (197)
Ascites (441)
Concentrated (4)
Liquid (4,028)
Lyophilized (433)
Precipitation (48)
Purified (377,080)
Supernatant (413)

1 – 15 of 567,920 results

Novus Biologicals Factor VIII Antibody - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 4 publications

Pricing and Availability
Specifications

Antigen	Factor VIII
Gene Symbols	F8
Regulatory Status	RUO
Purification Method	Affinity Purified
Target Species	Mouse,Rat
Host Species	Rabbit
Applications	Western Blot,Immunofluorescence,Immunohistochemistry (Paraffin)
Immunogen	A synthetic peptide made to a C-terminal portion of human Factor VIII (between amino acids 2100-2250) [UniProt P00451]

Novus Biologicals NPLOC4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications

Pricing and Availability
Specifications

Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin)
Isotype	IgG
Antigen	NPLOC4
Gene Symbols	NPLOC4
Regulatory Status	RUO
Purification Method	Affinity Purified
Gene Alias	FLJ20657, FLJ23742, KIAA1499nuclear protein localization protein 4 homolog, NPL4Protein NPL4, nuclear protein localization 4 homolog (S. cerevisiae)
Gene ID (Entrez)	55666
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids:VRDECLLPCKDAPELGYAKESSSEQYVPDVFYKDVDKFGNEITQLARPLPVEYLIIDITTTFPKDPVYTFSISQNPFPIENRDVLGETQDFHSLATYLSQNTSSVFLDTISDFHLLLFLVTNE
Classification	Polyclonal
Primary or Secondary	Primary
Test Specificity	Specificity of human NPLOC4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Novus Biologicals PGC1 alpha Antibody - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 156 publications

Pricing and Availability
Specifications

Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Target Species	Human,Mouse,Rat,Pig,Goat,Hamster,Sheep,Squirrel
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,ChIP Assay,Flow Cytometry,Immunohistochemistry,Immunocytochemistry,Immunoprecipitation
Isotype	IgG
Gene Accession No.	Q9UBK2
Research Discipline	Cancer, Cholesterol Metabolism, Chromatin Research, Diabetes Research, Lipid and Metabolism, mTOR Pathway, Neuroscience, Transcription Factors and Regulators
Concentration	1.0 mg/mL
Antigen	PGC1 alpha
Gene Symbols	PPARGC1A
Regulatory Status	RUO
Purification Method	Affinity Purified
Dilution	Western Blot 1 - 2 ug/ml, Chromatin Immunoprecipitation reported by customer review, Flow Cytometry 1 - 2.5 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1:1000. Use reported in scientific literature (PMID 24508229), Immunoprecipitation reported in scientific literature (PMID 24769256), Immunohistochemistry-Paraffin 1:200, Immunohistochemistry-Frozen reported in scientific literature (PMID 25981953), Flow (Intracellular) 1 - 2.5 ug/ml, Chromatin Immunoprecipitation (ChIP), Knockout Validated, KnockDown Validated reported in scientific literature (PMID 35455432)
Molecular Weight of Antigen	91 kDa
Gene Alias	LEM6, Ligand effect modulator 6, ligand effect modulator-6, L-PGC-1alpha, peroxisome proliferative activated receptor, gamma, coactivator 1, alpha, peroxisome proliferator-activated receptor gamma coactivator 1 alpha transcript variant B4-3ext, peroxisome proliferator-activated receptor gamma coactivator 1 alpha transcript variant B4-8a, peroxisome proliferator-activated receptor gamma coactivator 1 alpha transcript variant B5-NT, peroxisome proliferator-activated receptor gamma coactivator 1-alpha, peroxisome proliferator-activated receptor gamma, coactivator 1 alpha, PGC1, PGC-1(alpha), PGC1A, PGC-1-alpha, PGC1APGC-1(alpha), PGC1peroxisome proliferative activated receptor, gamma, coactivator 1, PGC-1v, PPAR gamma coactivator variant form, PPAR gamma coactivator-1, PPARgamma coactivator 1alpha, PPAR-gamma coactivator 1-alpha, PPARGC1, PPARGC-1-alpha
Gene ID (Entrez)	10891
Formulation	PBS with 0.02% Sodium Azide
Immunogen	This PGC1 alpha Antibody was developed against a recombinant protein made to an internal portion of the human PGC-1 alpha protein (within residues 400-550). [Swiss-Prot# Q9UBK2].
Classification	Polyclonal
Primary or Secondary	Primary
Test Specificity	Human and Mouse. Squirrel reactivity reported in the scientific literature. Expected reactivity based on sequence identity: monkey (98%), equine (94%), canine (93%) and rat (88%). Rat reactivity reported in scientific literature (PMID: 22208735).

Novus Biologicals 2A Peptide Antibody (3H4R), FITC, Novus Biologicals™

Mouse Monoclonal Antibody

Pricing and Availability

Novus Biologicals™ Lipase Activity Assay Kit (Colorimetric)

Assay Kit (Colorimetric)

Pricing and Availability

Novus Biologicals Tyrosine Hydroxylase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 147 publications

Pricing and Availability

Novus Biologicals BATF3 Antibody (841702) [DyLight 405], Novus Biologicals™

Mouse Monoclonal Antibody

Pricing and Availability

Novus Biologicals™ PAP Pen Fine Tip

Pricing and Availability

Novus Biologicals EAAT1/GLAST-1/SLC1A3 Antibody - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 18 publications

Pricing and Availability
Specifications

Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Target Species	Human,Mouse,Rat
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,Flow Cytometry,ELISA,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin)
Isotype	IgG
Gene Accession No.	P24942
Research Discipline	Cellular Markers, Cognition and Behavior
Concentration	1.0 mg/mL
Antigen	EAAT1/GLAST-1/SLC1A3
Gene Symbols	SLC1A3
Regulatory Status	RUO
Purification Method	Affinity Purified
Dilution	Western Blot 2 μg/mL, Flow Cytometry 1:200-1:500, ELISA 1:100 - 1:2000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1:10-1:500, Immunohistochemistry-Paraffin 1:50-1:500, Immunohistochemistry-Frozen 1:10-1:500, Flow (Intracellular) 1:500
Molecular Weight of Antigen	60 kDa
Gene Alias	EA6FLJ25094, EAAT1GLAST-1, excitatory amino acid transporter 1, GLAST, GLASTGLAST1, Sodium-dependent glutamate/aspartate transporter 1, solute carrier family 1 (glial high affinity glutamate transporter), member 3, Solute carrier family 1 member 3
Gene ID (Entrez)	6507
Formulation	PBS with 0.02% Sodium Azide
Immunogen	A synthetic peptide made to a C-terminal portion of the rat SLC1A3 protein (between residues 500-542) [Uniprot: P24942]
Classification	Polyclonal
Primary or Secondary	Primary
Test Specificity	Human, rat and mouse. Based upon 100% immunogen sequence similarity, this antibody is predicted to cross-react with Bovine also.

Novus Biologicals LC3B Antibody - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 316 publications

Pricing and Availability
Specifications

Content And Storage	Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Target Species	Human,Mouse,Rat,Pig,Bacteria,Bovine,Canine,Primate,Zebrafish
Host Species	Rabbit
Conjugate	Unconjugated
Applications	Western Blot,Flow Cytometry,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunoprecipitation,Immunohistochemistry (Paraffin),Immunohistochemistry (Frozen),Immunoblot,Immunoassay,Immunohistochemistry (Free Floating),KnockDown
Isotype	IgG
Gene Accession No.	Q9GZQ8
Research Discipline	Autophagy, Cancer, Cardiovascular Biology, Cellular Markers, Hypoxia, Innate Immunity, Lipid and Metabolism, Macroautophagy, Mitophagy, Neuroscience
Concentration	1.0 mg/mL
Antigen	LC3B
Gene Symbols	MAP1LC3B
Regulatory Status	RUO
Purification Method	Affinity Purified
Dilution	Western Blot 1:1000, Simple Western 1:100, Flow Cytometry 1:200, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 0.1-2 ug/ml, Immunoprecipitation, Immunohistochemistry-Paraffin 1:200-1:400, Immunohistochemistry-Frozen 1:400, Immunoblotting, Electron Microscopy, Immunohistochemistry Free-Floating, Knockout Validated, Knockdown Validated
Molecular Weight of Antigen	14.688 kDa
Gene Alias	ATG8F, Autophagy-related protein LC3 B, Autophagy-related ubiquitin-like modifier LC3 B, LC3B, lc3b autophagy marker, lc3-i, ii, MAP1 light chain 3-like protein 2, MAP1A/1BLC3, MAP1A/MAP1B LC3 B, map1lc3b, MAP1LC3B-a, microtubule associated protein 1 light chain 3 beta, microtubule associated protein 3 b, microtubule associated protein 3 beta, microtubule-associated proteins 1A/1B light chain 3, microtubule-associated proteins 1A/1B light chain 3B
Gene ID (Entrez)	81631
Formulation	PBS with 0.02% Sodium Azide
Immunogen	Polyclonal LC3B Antibody was made to a synthetic peptide made to the N-terminal region of the human LC3B protein. [Uniprot: Q9GZQ8]
Classification	Polyclonal
Primary or Secondary	Primary
Test Specificity	Human, mouse, rat and bovine. Zebrafish reactivity reported in scientific literature (PMID: 23724125). Canine and primate reactivity reported in scientific literature (PMID: 24027311) Porcine reactivity reported in scientific literature (PMID: 25378587) Other species have not been tested.