accessibility menu, dialog, popup

UserName
Bio Techne logo

Bio Techne

Bio-Techne is a global developer, manufacturer, and supplier of high-quality reagents, analytical instruments, and precision diagnostics. Whether you’re at the cutting edge of academic research, translating basic discoveries into therapeutic leads, or at a facility that requires the highest level of diagnostic testing, our award-winning tools and solutions empower scientists and clinicians to achieve reproducible and consistent results. Choosing Bio‑Techne means having confidence that every solution you use will help move you towards better answers.

Top Categories

Antibodies

Antibodies are essential tools for biomedical research as they allow researchers to identify specific proteins or molecules. Our catalog of over 425,000 antibodies from our R&D Systems™ and Novus Biologicals™ brands have been validated for specificity and reproducibility in over 25 species for more than 15 applications, ensuring that you will find one for your research needs.

Find Your Antibodies
Antibodies

Cell Culture Reagents and Assays

Your unique cell cultures require a consistent foundation whether you are using classical or specialty media, sera, supplements, and matrices. Thorough cell characterization is also critical to determine if the phenotype is what you need for your particular application.

Find Your Cell Culture Reagents
Cell Culture Reagents and Assays

ELISA Kits

Have confidence in your results with R&D Systems™ rigorously validated and tested ELISA kits. As the most published ELISA supplier, with more than 30 years of experience designing and optimizing quantitative immunoassays, you can trust that you have publishable, reproducible data every time.

Find Your ELISA Kits
ELISA Kits

Fluorescent Dyes and Probes

Fluorescent and bioluminescent reagents enable highly sensitive and selective visualization of biological events, from single molecule tracking in vitro through to in vivo imaging. Discover our exclusive range of fluorescent probes, indicators, dyes, and stains.

Find Your Dyes and Probes
Fluorescent Dyes and Probes

Recombinant Proteins

Bio-Techne offers over 5,000 R&D Systems™ bioactive recombinant proteins spanning 35 species and multiple research areas. Our portfolio includes cytokines and growth factors, proteins for studying immuno-oncology targets, enzymes, and animal-free and GMP-grade proteins, as well as custom protein development services and more.

Find Your Recombinant Proteins
Recombinant Proteins

Small Molecules and Peptides

Small molecules and peptides can be used in all stages of biological and biomedical research. Bio-Techne’s unique collection of small molecules and peptides includes high quality, novel, and innovative compounds such as enzyme inhibitors, ion channel modulators, GPCR agonists and antagonists, fluorescent probes and dyes, and molecular biology tools.

Find Your Small Molecules
Small Molecules and Peptides

Related Resources

Optimizing Organoid Culture Conditions:
Optimizing Organoid Culture Conditions
An application note demonstrating the value of R&D Systems™ proteins for achieving robust, reproducible organoid culture conditions
Filename
23227_bio_techne_optimizing_organoids_Fisherised_v2.pdf
Size
1 MB
Format
application/pdf
Realize Your Protein and Cell Potential
Realize Your Protein and Cell Potential
Realize your protein and cell potential
Filename
23227_bio_techne_realize_protein_Fisherised.pdf
Size
3 MB
Format
application/pdf
Organ-on-a-Chip Technology:
Organ-on-a-Chip Technology
Progress, challenges, and an exciting future
Filename
23227_bio_techne_organ_on_a_chip_technology_progress_Fisherised.pdf
Size
326 KB
Format
application/pdf

Fisher Scientific Europe Announces a New Distribution Agreement with Bio-Techne in Europe

Paris, France 01-05-2024

 

Thermo Fisher Scientific, a leading provider of laboratory products and services, is pleased to announce a significant milestone in its commitment to providing cutting-edge solutions to its customers. Effective May 1, 2024, Thermo Fisher will enter into a strategic European distribution agreement with Bio-Techne (NASDAQ: TECH), a global life sciences company providing innovative tools and bioactive reagents for the research and clinical diagnostic communities.

This partnership marks an important collaboration between two industry leaders in the fields of scientific research, diagnostics, and biotechnology. Under this agreement, Thermo Fisher, through the Fisher Scientific channel, Europe, will distribute Bio-Techne's extensive portfolio of innovative products, including antibodies, proteins, immunoassay kits, reagents and enzymes to laboratories and research institutions across Europe.

"We are thrilled to forge this partnership with Bio-Techne, a company renowned for its pioneering advancements in the life sciences industry," said Claire Wallace, President, Fisher Scientific channel, Europe. "By adding Bio-Techne's high-quality products to our comprehensive portfolio, we aim to further empower scientists and researchers with the tools they need to drive breakthrough discoveries and advancements in healthcare."

Bio-Techne's state-of-the-art products are designed to accelerate research and improve outcomes in areas including cell and gene therapy, immunology, neuroscience, and more. With this collaboration, Thermo Fisher reinforces its commitment to providing customers with access to the latest technologies and expertise, ultimately advancing scientific knowledge and improving human health.

"We are excited to partner with Thermo Fisher to expand the reach of our products and services throughout Europe," said Kim Kelderman, Bio-Techne’s President and Chief Executive Officer. "By leveraging the Fisher Scientific Channel's extensive European distribution network and industry expertise, we aim to enhance support for researchers and accelerate scientific discoveries that address some of the most pressing challenges in healthcare today."

This distribution agreement underscores Thermo Fisher's dedication to fostering innovation and collaboration within the scientific community. Through strategic partnerships with leading companies like Bio-Techne, Thermo Fisher continues to strengthen its position as a trusted partner for researchers and laboratories across Europe.

About Bio-Techne

Bio-Techne Corporation (NASDAQ: TECH) is a global life sciences company providing innovative tools and bioactive reagents for the research and clinical diagnostic communities. Bio-Techne products assist scientific investigations into biological processes and the nature and progress of specific diseases. They aid in drug discovery efforts and provide the means for accurate clinical tests and diagnoses. With thousands of products in its portfolio, Bio-Techne generated over $1.1 billion in net sales in fiscal year 2023 and has approximately 3,100 employees worldwide.

 

Questions? Reach Out to a Specialist >

 

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Narrow Results

category

special offers

  • (1)
  • (4,969)

special programs

  • (191)

Conjugate

  • (3)
  • (18,983)
  • (4)
  • (2,829)
  • (4)
  • (4)
  • (17)
  • (20,932)
  • (21,172)
  • (21,104)
  • (22,267)
  • (20,929)
  • (21,156)
  • (21,134)
  • (20,902)
  • (4)
  • (262)
  • (2)
  • (3)
  • (2)
  • (3)
  • (3)
  • (27,008)
  • (14,841)
  • (3)
  • (3)
  • (2)
  • (2)
  • (2)
  • (26,857)
  • (26,851)
  • (26,865)
  • (11)
  • (26,834)
  • (26,645)
  • (29)
  • (14)
  • (26,770)
  • (26,835)
  • (26,855)
  • (38)
  • (25,584)
  • (113)
  • (2)
  • (26,670)
  • (1)
  • (3)
  • (9,947)
  • (25,463)
  • (1,696)
  • (1,695)
  • (25,413)
  • (9,903)
  • (1)
  • (18,939)
  • (14)
  • (2,834)
  • (2,850)
  • (2,829)
  • (4)
  • (4)
  • (3)
  • (4)
  • (20,813)
  • (11)
  • (4)
  • (8)
  • (150)
  • (2)
  • (19)
  • (142)
  • (156,838)
  • (2)
  • (18,536)
  • (18,487)
  • (18,482)

Applications

  • (65)
  • (133)
  • (166)
  • (18)
  • (5)
  • (464)
  • (106)
  • (5)
  • (2,165)
  • (645)
  • (1,649)
  • (1)
  • (54)
  • (72)
  • (1)
  • (8)
  • (127)
  • (42,380)
  • (2)
  • (36)
  • (114)
  • (93)
  • (1,589)
  • (365)
  • (272,235)
  • (5,623)
  • (5,512)
  • (5,582)
  • (21)
  • (59)
  • (163,566)
  • (291)
  • (7,669)
  • (3)
  • (6)
  • (309)
  • (7,317)
  • (7)
  • (24)
  • (92)
  • (4,366)
  • (69)
  • (67)
  • (6)
  • (36)
  • (2,952)
  • (1,537)
  • (120,800)
  • (51,927)
  • (336)
  • (38)
  • (162,991)
  • (340,236)
  • (650)
  • (21,266)
  • (24)
  • (277,275)
  • (18)
  • (48)
  • (467)
  • (42,634)
  • (52)
  • (202)
  • (38)
  • (234)
  • (97)
  • (142)
  • (7,175)
  • (99)
  • (8)
  • (6)
  • (136)
  • (5)
  • (132)
  • (967)
  • (2)
  • (10,603)
  • (1)
  • (18)
  • (3)
  • (1,320)
  • (93)
  • (6,995)
  • (323)
  • (2)
  • (3)
  • (444)
  • (3)
  • (7)
  • (729)
  • (4,301)
  • (135)
  • (142)
  • (2,629)
  • (75)
  • (2)
  • (22)
  • (103)
  • (11)
  • (521,252)
  • (453)
  • (15)

Target Species

  • (20)
  • (27)
  • (128)
  • (1,247)
  • (133)
  • (30)
  • (556)
  • (17)
  • (32)
  • (498)
  • (668)
  • (38)
  • (2,434)
  • (200)
  • (15)
  • (16,121)
  • (736)
  • (1,538)
  • (98)
  • (22)
  • (858)
  • (6)
  • (27)
  • (20,668)
  • (593)
  • (5,078)
  • (264)
  • (347)
  • (540)
  • (141)
  • (2)
  • (21)
  • (1,523)
  • (240)
  • (30)
  • (36)
  • (4)
  • (1,228)
  • (97)
  • (9)
  • (970)
  • (74)
  • (1)
  • (6,939)
  • (78)
  • (2)
  • (2,598)
  • (65)
  • (504)
  • (182)
  • (1)
  • (75)
  • (872)
  • (16)
  • (121)
  • (82)
  • (1,859)
  • (13)
  • (173)
  • (25)
  • (5,858)
  • (92)
  • (230)
  • (176)
  • (149)
  • (127)
  • (107)
  • (2,395)
  • (208)
  • (2)
  • (1)
  • (740,660)
  • (450)
  • (1)
  • (1)
  • (93)
  • (51)
  • (7)
  • (84)
  • (391)
  • (233)
  • (302)
  • (20)
  • (75)
  • (10)
  • (95)
  • (287)
  • (797)
  • (742)
  • (2)
  • (13)
  • (97)
  • (12,122)
  • (65)
  • (2)
  • (291,256)
  • (3,466)
  • (15)
  • (289)
  • (8)
  • (47)
  • (3,268)
  • (1)
  • (2)
  • (198)
  • (43)
  • (162)
  • (35)
  • (125)
  • (11,792)
  • (29)
  • (541)
  • (16)
  • (443)
  • (12,573)
  • (73)
  • (234)
  • (2)
  • (9,945)
  • (307)
  • (197,017)
  • (3,908)
  • (1)
  • (202)
  • (326)
  • (9)
  • (20)
  • (21)
  • (143)
  • (27)
  • (5)
  • (661)
  • (2,795)
  • (2,799)
  • (206)
  • (5)
  • (43)
  • (13)
  • (74)
  • (522)
  • (47)
  • (7)
  • (1,013)
  • (10,846)
  • (30)
  • (137)
  • (1,496)
  • (1,353)
  • (3,793)

Classification

  • (453,231)
  • (379,271)

Host Species

  • (957)
  • (23)
  • (8)
  • (1,455)
  • (632)
  • (17)
  • (2)
  • (23,243)
  • (42)
  • (48)
  • (420)
  • (9,280)
  • (34)
  • (30)
  • (335,276)
  • (1)
  • (28)
  • (5)
  • (414,376)
  • (30,410)
  • (15,550)
  • (1)
  • (1)

Quantity

  • (1)
  • (2)
  • (1)
  • (3,050)
  • (908)
  • (2,423)
  • (4,262)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1,306)
  • (3,305)
  • (667,346)
  • (16,204)
  • (9)
  • (823)
  • (54)
  • (1)
  • (5)
  • (1)
  • (3,690)
  • (781)
  • (1,234)
  • (184)
  • (1)
  • (4)
  • (1)
  • (6,189)
  • (563)
  • (1)
  • (3)
  • (3)
  • (7)
  • (24)
  • (1)
  • (2,055)
  • (1,905)
  • (2)
  • (1)
  • (70)
  • (1)
  • (17)
  • (1)
  • (30)
  • (3)
  • (1)
  • (123)
  • (26,159)
  • (47,866)
  • (1)
  • (1)
  • (49)
  • (4)
  • (2)
  • (7)
  • (10)
  • (6)
  • (36)
  • (1)
  • (4)
  • (1)
  • (1)
  • (1)
  • (1)
  • (15)
  • (1)
  • (2)
  • (1)
  • (7)
  • (51)
  • (344)
  • (3,589)
  • (4,049)
  • (5)
  • (64)
  • (97)
  • (153)
  • (1)
  • (3)
  • (1)
  • (1)
  • (16,813)
  • (2,075)
  • (1)
  • (7)
  • (14)
  • (7)
  • (87)
  • (5)
  • (1)
  • (2,135)
  • (5)
  • (198)
  • (1)
  • (7)
  • (1)
  • (3)
  • (1)
  • (4)
  • (14)
  • (525)
  • (9)
  • (2)
  • (13)
  • (904)
  • (8,315)
  • (1)
  • (3)
  • (2)
  • (7)
  • (38)
  • (705)
  • (1)
  • (35)
  • (6)
  • (1)
  • (9)
  • (15)
  • (1)
  • (662)
  • (5)
  • (8)

Isotype

  • (99)
  • (54)
  • (25)
  • (1)
  • (43)
  • (2)
  • (2)
  • (435,059)
  • (21,283)
  • (503)
  • (140,444)
  • (60,451)
  • (752)
  • (28)
  • (53)
  • (7,209)
  • (235)
  • (1,875)
  • (122)
  • (54,393)
  • (17,664)
  • (534)
  • (35)
  • (53,457)
  • (18,282)
  • (589)
  • (4)
  • (23)
  • (570)
  • (1,862)
  • (27)
  • (1,798)
  • (1,208)
  • (44)
  • (906)
  • (153)
  • (33)
  • (422)
  • (290)
  • (31)
  • (1,059)
  • (17)

Regulatory Status

  • (759,965)

Form

  • (708)
  • (743)
  • (19)
  • (1)
  • (1)
  • (4,074)
  • (2,378)
  • (5)
  • (109)
  • (689,940)
  • (4)
  • (1)
  • (2)
  • (729)
  • (1)

For Use With (Application)

  • (2,709)
  • (1,921)
  • (8)
  • (2)
  • (4)
  • (2)
  • (1)
  • (1)
  • (25)
  • (305)
  • (20,273)
  • (2)
  • (4)
  • (37)
  • (48)
  • (99)
  • (1)
  • (3)
  • (30)
  • (26)
  • (7)
  • (3)
  • (10)
  • (546)
  • (19,634)
  • (8)
  • (34)
  • (20)
  • (68)
  • (235)
  • (562)
  • (9)
  • (322)
  • (16)
  • (2)
  • (78)
  • (141)
  • (88)
  • (1)
  • (68)
  • (1)
  • (11)
  • (4)
  • (4,212)
  • (4)
  • (3)
  • (19,542)
  • (6)
  • (1)
  • (6,371)
  • (4)
  • (2)
  • (5)
  • (1)
  • (3)
  • (1)
  • (19,912)
  • (5)
  • (1)

1 – 15 of 946,927 results
1

Ferroportin/SLC40A1 Antibody - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Antigen Ferroportin/SLC40A1
Target Species Human,Mouse,Pig,Bovine
Host Species Rabbit
Applications Western Blot,Immunohistochemistry (Paraffin)
2

LC3B Antibody - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1218 publications

Content And Storage Store at -20°C.
Target Species Human,Mouse,Rat,Pig,Alligator,Avian,Bacteria,Bovine,Canine,Chicken,Guinea Pig,Hamster,Invertebrate,Monkey,Primate,Rabbit,Golden Syrian Hamster,Zebrafish
Host Species Rabbit
Conjugate Unconjugated
Applications ChIP Assay,ELISA,Flow Cytometry,Immunoassay,Immunoblot,Immunocytochemistry,Immunofluorescence,Immunohistochemistry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Immunoprecipitation,In situ PLA,KnockDown
Isotype IgG
Gene Accession No. Q9GZQ8
Research Discipline Autophagy, Cancer, Cardiovascular Biology, Cellular Markers, Hypoxia, Innate Immunity, Lipid and Metabolism, Macroautophagy, Mitophagy, Neuroscience
Concentration 1.0 mg/mL
Antigen LC3B
Gene Symbols MAP1LC3B
Regulatory Status RUO
Purification Method Affinity Purified
Dilution Western Blot 0.5 - 2.0 ug/mL, Simple Western 1:50, Flow Cytometry, ELISA, Immunohistochemistry 1:200 - 1:400, Immunocytochemistry/Immunofluorescence 1:200, Immunoprecipitation 20 ug/500 ug of protein, Immunohistochemistry-Paraffin 1:200 - 1:400, Immunohistochemistry-Frozen, Immunoblotting, Proximity Ligation Assay, SDS-Page, Chromatin Immunoprecipitation (ChIP), Knockout Validated, KnockDown Validated
Molecular Weight of Antigen 14.688 kDa
Gene Alias anti-LC3B, ATG8F, Autophagy-related protein LC3 B, Autophagy-related ubiquitin-like modifier LC3 B, LC3B, lc3b autophagy marker, LC3B ihc, LC3B immunohistochemistry, LC3B immunoprecipitation, LC3B western blot, lc3-i, ii, MAP1 light chain 3-like protein 2, MAP1A/1BLC3, MAP1A/MAP1B LC3 B, map1lc3b, MAP1LC3B-a, microtubule associated protein 1 light chain 3 beta, microtubule associated protein 3 b, microtubule associated protein 3 beta, microtubule-associated proteins 1A/1B light chain 3, microtubule-associated proteins 1A/1B light chain 3B
Gene ID (Entrez) 81631
Formulation PBS with 0.02% Sodium Azide
Immunogen Polyclonal LC3B Antibody was made to a synthetic peptide made to an N-terminal portion of the human LC3B protein sequence (between residues 1-100). [UniProt# Q9GZQ8]
Classification Polyclonal
Primary or Secondary Primary
Test Specificity Human, rat, mouse, zebrafish, bacteria, hamster, and porcine. Bovine reactivity reported in scientific literature (PMID: 24895572) Primate reactivity reported in scientific literature (PMID: 25142602) The mouse detection has been reported to be weaker than the human. Immunogen sequence has 84% homology to Xenopus.
3

Novus Biologicals™ Multi-Species dsRNA ELISA Kit (Colorimetric)

ELISA kits are ideal for the quantification of target antigens in tissue extracts, serum and cell culture.

Target Multi-Species
Specificity The dsRNA Detection Kit allows sensitive and selective detection of dsRNA molecules (larger than 30-40 bp), independent of their nucleotide composition and sequence.
Product Type ELISA Kit (Colorimetric)
Synonym Double-stranded RNA
Assay Sensitivity 3 ng/ml
Storage Requirements Store at 4°C short term. Store at -20°C long term. Avoid freeze-thaw cycles.
Assay Range 1 - 300 ng/ml (0.1 - 30 ng/well)
For Use With (Application) ELISA
4

GFP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Target Species C. elegans,Plant
5

Proinsulin Antibody (CCI-17), Novus Biologicals™

Mouse Monoclonal Antibody has been used in 2 publications

6

Novus Biologicals™ beta 2-Microglobulin Protein

Highly purified. Generating reliable and reproducible results.

Regulatory Status RUO
Purification Method SDS-PAGE
Purity or Quality Grade >95%
Conjugate Unconjugated
Common Name beta 2-Microglobulin
Molecular Weight (g/mol) 14.0kDa
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 20% glycerol, 2mM DTT, 100mM NaCl
Storage Requirements Store at -80°C. Avoid freeze-thaw cycles.
Concentration 0.5mg/mL
For Use With (Application) SDS-PAGE
9

Novus Biologicals™ Recombinant Human alpha-Synuclein Aggregate Protein (Biologically Active)

Highly purified and high bioactivity. Generating reliable and reproducible results.

Conjugate Unconjugated
Gene Symbol SNCA
For Use With (Application) In vitro Assay,In vivo Assay,SDS-PAGE,Western Blot
Source E.Coli
Name Human alpha-Synuclein Aggregate Protein
Regulatory Status RUO
Purification Method >95% pure by SDS-PAGE
Gene Alias alpha-Synuclein, Lewy body 4, MGC110988, non A-beta component of AD amyloid, Non-A beta component of AD amyloid, non-A4 component of amyloid, Non-A4 component of amyloid precursor, PARK1, PARK4, synuclein, alpha (non A4 component of amyloid precursor)
Product Type Recombinant Protein
Gene ID (Entrez) 6622
Formulation PBS
Immunogen MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Cross Reactivity Human
Recombinant Recombinant
12

AHR Antibody (RPT9) - BSA Free, Novus Biologicals™

Mouse Monoclonal Antibody has been used in 7 publications

13

CD117/c-kit Antibody (9D2) - Azide and BSA Free, Novus Biologicals™

Rat Monoclonal Antibody

Content And Storage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Target Species Mouse
Host Species Rat
Conjugate Unconjugated
Applications Immunohistochemistry (Paraffin),Western Blot,Immunohistochemistry
Form Purified
Isotype IgG2
Gene Accession No. P05532
Research Discipline Cancer, Cytokine Research, Hematopoietic Stem Cell Markers, Immunology, Innate Immunity, Mast Cell Markers, Mesenchymal Stem Cell Markers, Protein Kinase, Signal Transduction, Stem Cell Markers, Tyrosine Kinases
Concentration LYOPH
Antigen CD117/c-kit
Gene Symbols KIT
Regulatory Status RUO
Purification Method Protein G purified
Dilution Western Blot 1:100-1:1000, Immunohistochemistry 1:100-1:400, Immunohistochemistry-Paraffin 1:100-1:400
Gene Alias CD117, CD117 antigen, ckit, C-Kit, EC 2.7.10, EC 2.7.10.1, PBT, piebald trait, Proto-oncogene c-Kit, proto-oncogene tyrosine-protein kinase Kit, SCFRmast/stem cell growth factor receptor, soluble KIT variant 1, Tyrosine-protein kinase Kit, v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog, v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene-like protein
Gene ID (Entrez) 3815
Classification Monoclonal
Primary or Secondary Primary
Clone 9D2
14

Novus Biologicals™ Human, Mouse, Rat p62/SQSTM1 ELISA Kit (Colorimetric)

Highly purified and high bioactivity. Generating reliable and reproducible results.

Bio Techne