Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.
1
–
15
of
953,550
results

Antigen | Ferroportin/SLC40A1 |
---|---|
Target Species | Human,Mouse,Pig,Bovine |
Host Species | Rabbit |
Applications | Western Blot,Immunohistochemistry (Paraffin) |
LC3B Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1218 publications
Content And Storage | Store at -20°C. |
---|---|
Target Species | Human,Mouse,Rat,Pig,Alligator,Avian,Bacteria,Bovine,Canine,Chicken,Guinea Pig,Hamster,Invertebrate,Monkey,Primate,Rabbit,Golden Syrian Hamster,Zebrafish |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | ChIP Assay,ELISA,Flow Cytometry,Immunoassay,Immunoblot,Immunocytochemistry,Immunofluorescence,Immunohistochemistry,Immunohistochemistry (Frozen),Immunohistochemistry (Paraffin),Immunoprecipitation,In situ PLA,KnockDown |
Isotype | IgG |
Gene Accession No. | Q9GZQ8 |
Research Discipline | Autophagy, Cancer, Cardiovascular Biology, Cellular Markers, Hypoxia, Innate Immunity, Lipid and Metabolism, Macroautophagy, Mitophagy, Neuroscience |
Concentration | 1.0 mg/mL |
Antigen | LC3B |
Gene Symbols | MAP1LC3B |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Dilution | Western Blot 0.5 - 2.0 ug/mL, Simple Western 1:50, Flow Cytometry, ELISA, Immunohistochemistry 1:200 - 1:400, Immunocytochemistry/Immunofluorescence 1:200, Immunoprecipitation 20 ug/500 ug of protein, Immunohistochemistry-Paraffin 1:200 - 1:400, Immunohistochemistry-Frozen, Immunoblotting, Proximity Ligation Assay, SDS-Page, Chromatin Immunoprecipitation (ChIP), Knockout Validated, KnockDown Validated |
Molecular Weight of Antigen | 14.688 kDa |
Gene Alias | anti-LC3B, ATG8F, Autophagy-related protein LC3 B, Autophagy-related ubiquitin-like modifier LC3 B, LC3B, lc3b autophagy marker, LC3B ihc, LC3B immunohistochemistry, LC3B immunoprecipitation, LC3B western blot, lc3-i, ii, MAP1 light chain 3-like protein 2, MAP1A/1BLC3, MAP1A/MAP1B LC3 B, map1lc3b, MAP1LC3B-a, microtubule associated protein 1 light chain 3 beta, microtubule associated protein 3 b, microtubule associated protein 3 beta, microtubule-associated proteins 1A/1B light chain 3, microtubule-associated proteins 1A/1B light chain 3B |
Gene ID (Entrez) | 81631 |
Formulation | PBS with 0.02% Sodium Azide |
Immunogen | Polyclonal LC3B Antibody was made to a synthetic peptide made to an N-terminal portion of the human LC3B protein sequence (between residues 1-100). [UniProt# Q9GZQ8] |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Human, rat, mouse, zebrafish, bacteria, hamster, and porcine. Bovine reactivity reported in scientific literature (PMID: 24895572) Primate reactivity reported in scientific literature (PMID: 25142602) The mouse detection has been reported to be weaker than the human. Immunogen sequence has 84% homology to Xenopus. |
Novus Biologicals™ Multi-Species dsRNA ELISA Kit (Colorimetric)
ELISA kits are ideal for the quantification of target antigens in tissue extracts, serum and cell culture.
Target | Multi-Species |
---|---|
Specificity | The dsRNA Detection Kit allows sensitive and selective detection of dsRNA molecules (larger than 30-40 bp), independent of their nucleotide composition and sequence. |
Product Type | ELISA Kit (Colorimetric) |
Synonym | Double-stranded RNA |
Assay Sensitivity | 3 ng/ml |
Storage Requirements | Store at 4°C short term. Store at -20°C long term. Avoid freeze-thaw cycles. |
Assay Range | 1 - 300 ng/ml (0.1 - 30 ng/well) |
For Use With (Application) | ELISA |
Target Species | C. elegans,Plant |
---|
Proinsulin Antibody (CCI-17), Novus Biologicals™
Mouse Monoclonal Antibody has been used in 2 publications
Novus Biologicals™ beta 2-Microglobulin Protein
Highly purified. Generating reliable and reproducible results.
Regulatory Status | RUO |
---|---|
Purification Method | SDS-PAGE |
Purity or Quality Grade | >95% |
Conjugate | Unconjugated |
Common Name | beta 2-Microglobulin |
Molecular Weight (g/mol) | 14.0kDa |
Formulation | Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 20% glycerol, 2mM DTT, 100mM NaCl |
Storage Requirements | Store at -80°C. Avoid freeze-thaw cycles. |
Concentration | 0.5mg/mL |
For Use With (Application) | SDS-PAGE |
Novus Biologicals™ Recombinant Human alpha-Synuclein Aggregate Protein (Biologically Active)
Highly purified and high bioactivity. Generating reliable and reproducible results.
Conjugate | Unconjugated |
---|---|
Gene Symbol | SNCA |
For Use With (Application) | In vitro Assay,In vivo Assay,SDS-PAGE,Western Blot |
Source | E.Coli |
Name | Human alpha-Synuclein Aggregate Protein |
Regulatory Status | RUO |
Purification Method | >95% pure by SDS-PAGE |
Gene Alias | alpha-Synuclein, Lewy body 4, MGC110988, non A-beta component of AD amyloid, Non-A beta component of AD amyloid, non-A4 component of amyloid, Non-A4 component of amyloid precursor, PARK1, PARK4, synuclein, alpha (non A4 component of amyloid precursor) |
Product Type | Recombinant Protein |
Gene ID (Entrez) | 6622 |
Formulation | PBS |
Immunogen | MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA |
Cross Reactivity | Human |
Recombinant | Recombinant |
Baculovirus Envelope gp64 protein Antibody (AcV1), HRP, Novus Biologicals™
Mouse Monoclonal Antibody
AHR Antibody (RPT9) - BSA Free, Novus Biologicals™
Mouse Monoclonal Antibody has been used in 7 publications
LAMP-2/CD107b Antibody (H4B4) - BSA Free, Novus Biologicals™
Mouse Monoclonal Antibody has been used in 23 publications
Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
---|---|
Applications | Immunoblot,CyTOF,Immunoassay |
Isotype | IgG1 κ |
Antigen | ZER1 |
---|---|
Gene Symbols | ZER1 |
Regulatory Status | RUO |
Molecular Weight of Antigen | 88 kDa |
Gene Alias | C9orf60, chromosome 9 open reading frame 60, homolog of Zyg-11, Hzygzyg-11 homolog B (C. elegans)-like, protein zer-1 homolog, zer-1 homolog (C. elegans), ZYG homolog, Zyg-11 homolog B-like protein, ZYG11BL, ZYGRP11-545E17.4 |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot |
Gene ID (Entrez) | 10444 |
Immunogen | Synthetic peptides corresponding to ZER1 (zer-1 homolog (C. elegans)) The peptide sequence was selected from the middle region of ZER1. Peptide sequence LTNSEYRSEQSVKLRRQVIQVVLNGMESYQEVTVQRNCCLTLCNFSIPEE. |
Classification | Polyclonal |
Isotype | IgG |
Primary or Secondary | Primary |