accessibility menu, dialog, popup

UserName
Bio Techne logo

Bio Techne

Bio-Techne is a global developer, manufacturer, and supplier of high-quality reagents, analytical instruments, and precision diagnostics. Whether you’re at the cutting edge of academic research, translating basic discoveries into therapeutic leads, or at a facility that requires the highest level of diagnostic testing, our award-winning tools and solutions empower scientists and clinicians to achieve reproducible and consistent results. Choosing Bio‑Techne means having confidence that every solution you use will help move you towards better answers.

Top Categories

Antibodies

Antibodies are essential tools for biomedical research as they allow researchers to identify specific proteins or molecules. Our catalog of over 425,000 antibodies from our R&D Systems™ and Novus Biologicals™ brands have been validated for specificity and reproducibility in over 25 species for more than 15 applications, ensuring that you will find one for your research needs.

Find Your Antibodies
Antibodies

Cell Culture Reagents and Assays

Your unique cell cultures require a consistent foundation whether you are using classical or specialty media, sera, supplements, and matrices. Thorough cell characterization is also critical to determine if the phenotype is what you need for your particular application.

Find Your Cell Culture Reagents
Cell Culture Reagents and Assays

ELISA Kits

Have confidence in your results with R&D Systems™ rigorously validated and tested ELISA kits. As the most published ELISA supplier, with more than 30 years of experience designing and optimizing quantitative immunoassays, you can trust that you have publishable, reproducible data every time.

Find Your ELISA Kits
ELISA Kits

Fluorescent Dyes and Probes

Fluorescent and bioluminescent reagents enable highly sensitive and selective visualization of biological events, from single molecule tracking in vitro through to in vivo imaging. Discover our exclusive range of fluorescent probes, indicators, dyes, and stains.

Find Your Dyes and Probes
Fluorescent Dyes and Probes

Recombinant Proteins

Bio-Techne offers over 5,000 R&D Systems™ bioactive recombinant proteins spanning 35 species and multiple research areas. Our portfolio includes cytokines and growth factors, proteins for studying immuno-oncology targets, enzymes, and animal-free and GMP-grade proteins, as well as custom protein development services and more.

Find Your Recombinant Proteins
Recombinant Proteins

Small Molecules and Peptides

Small molecules and peptides can be used in all stages of biological and biomedical research. Bio-Techne’s unique collection of small molecules and peptides includes high quality, novel, and innovative compounds such as enzyme inhibitors, ion channel modulators, GPCR agonists and antagonists, fluorescent probes and dyes, and molecular biology tools.

Find Your Small Molecules
Small Molecules and Peptides

Related Resources

Optimizing Organoid Culture Conditions:

Optimizing Organoid Culture Conditions

An application note demonstrating the value of R&D Systems™ proteins for achieving robust, reproducible organoid culture conditions
Nome file
23227_bio_techne_optimizing_organoids_Fisherised_v2.pdf
Dimensione
1 MB
Formato
application/pdf
Realize Your Protein and Cell Potential

Realize Your Protein and Cell Potential

Realize your protein and cell potential
Nome file
23227_bio_techne_realize_protein_Fisherised.pdf
Dimensione
3 MB
Formato
application/pdf
Organ-on-a-Chip Technology:

Organ-on-a-Chip Technology

Progress, challenges, and an exciting future
Nome file
23227_bio_techne_organ_on_a_chip_technology_progress_Fisherised.pdf
Dimensione
326 KB
Formato
application/pdf

Fisher Scientific Europe Announces a New Distribution Agreement with Bio-Techne in Europe

Paris, France 01-05-2024

 

Thermo Fisher Scientific, a leading provider of laboratory products and services, is pleased to announce a significant milestone in its commitment to providing cutting-edge solutions to its customers. Effective May 1, 2024, Thermo Fisher will enter into a strategic European distribution agreement with Bio-Techne (NASDAQ: TECH), a global life sciences company providing innovative tools and bioactive reagents for the research and clinical diagnostic communities.

This partnership marks an important collaboration between two industry leaders in the fields of scientific research, diagnostics, and biotechnology. Under this agreement, Thermo Fisher, through the Fisher Scientific channel, Europe, will distribute Bio-Techne's extensive portfolio of innovative products, including antibodies, proteins, immunoassay kits, reagents and enzymes to laboratories and research institutions across Europe.

"We are thrilled to forge this partnership with Bio-Techne, a company renowned for its pioneering advancements in the life sciences industry," said Claire Wallace, President, Fisher Scientific channel, Europe. "By adding Bio-Techne's high-quality products to our comprehensive portfolio, we aim to further empower scientists and researchers with the tools they need to drive breakthrough discoveries and advancements in healthcare."

Bio-Techne's state-of-the-art products are designed to accelerate research and improve outcomes in areas including cell and gene therapy, immunology, neuroscience, and more. With this collaboration, Thermo Fisher reinforces its commitment to providing customers with access to the latest technologies and expertise, ultimately advancing scientific knowledge and improving human health.

"We are excited to partner with Thermo Fisher to expand the reach of our products and services throughout Europe," said Kim Kelderman, Bio-Techne’s President and Chief Executive Officer. "By leveraging the Fisher Scientific Channel's extensive European distribution network and industry expertise, we aim to enhance support for researchers and accelerate scientific discoveries that address some of the most pressing challenges in healthcare today."

This distribution agreement underscores Thermo Fisher's dedication to fostering innovation and collaboration within the scientific community. Through strategic partnerships with leading companies like Bio-Techne, Thermo Fisher continues to strengthen its position as a trusted partner for researchers and laboratories across Europe.

About Bio-Techne

Bio-Techne Corporation (NASDAQ: TECH) is a global life sciences company providing innovative tools and bioactive reagents for the research and clinical diagnostic communities. Bio-Techne products assist scientific investigations into biological processes and the nature and progress of specific diseases. They aid in drug discovery efforts and provide the means for accurate clinical tests and diagnoses. With thousands of products in its portfolio, Bio-Techne generated over $1.1 billion in net sales in fiscal year 2023 and has approximately 3,100 employees worldwide.

 

Questions? Reach Out to a Specialist >

 

Risultati della ricerca filtrata

I prodotti di alcuni dei nostri fornitori non vengono visualizzati nei risultati della ricerca filtrata. Si prega di deselezionare tutti i filtri per vedere questi prodotti.

Filtra risultati

Filtra risultati

categoria

programmi speciali

  • (6,735)

Applicazioni

  • (42)
  • (75)
  • (88)
  • (7)
  • (1)
  • (333)
  • (84)
  • (5)
  • (1,035)
  • (280)
  • (1,152)
  • (121)
  • (50)
  • (69)
  • (4)
  • (127)
  • (38,602)
  • (1)
  • (36)
  • (59)
  • (93)
  • (1,175)
  • (88)
  • (180,766)
  • (1,806)
  • (1,717)
  • (1,765)
  • (21)
  • (59)
  • (91,408)
  • (290)
  • (7,144)
  • (3)
  • (6)
  • (309)
  • (6,935)
  • (6)
  • (29)
  • (92)
  • (1,352)
  • (56)
  • (67)
  • (6)
  • (36)
  • (913)
  • (625)
  • (39,109)
  • (48,274)
  • (321)
  • (27)
  • (62,145)
  • (167,417)
  • (369)
  • (7,313)
  • (24)
  • (173,524)
  • (18)
  • (48)
  • (22)
  • (278)
  • (30,425)
  • (52)
  • (181)
  • (42)
  • (152)
  • (86)
  • (126)
  • (4,528)
  • (86)
  • (8)
  • (6)
  • (134)
  • (5)
  • (129)
  • (967)
  • (2)
  • (4,540)
  • (18)
  • (223)
  • (92)
  • (6,989)
  • (307)
  • (2)
  • (3)
  • (7)
  • (369)
  • (3)
  • (7)
  • (137)
  • (4,299)
  • (135)
  • (142)
  • (2,628)
  • (75)
  • (1)
  • (22)
  • (100)
  • (11)
  • (285,326)
  • (453)
  • (15)

Target Species

  • (5)
  • (27)
  • (78)
  • (12)
  • (408)
  • (70)
  • (12)
  • (288)
  • (8)
  • (20)
  • (258)
  • (366)
  • (24)
  • (1,192)
  • (140)
  • (6,609)
  • (341)
  • (629)
  • (173)
  • (2)
  • (6)
  • (5,992)
  • (273)
  • (2,332)
  • (137)
  • (251)
  • (236)
  • (97)
  • (2)
  • (4)
  • (1)
  • (918)
  • (2)
  • (115)
  • (11)
  • (17)
  • (500)
  • (41)
  • (8)
  • (537)
  • (74)
  • (1)
  • (4)
  • (1,668)
  • (39)
  • (1)
  • (1,392)
  • (29)
  • (215)
  • (127)
  • (1)
  • (49)
  • (308)
  • (55)
  • (53)
  • (676)
  • (1)
  • (87)
  • (10)
  • (1,045)
  • (38)
  • (173)
  • (61)
  • (46)
  • (27)
  • (49)
  • (1,020)
  • (109)
  • (416,338)
  • (285)
  • (1)
  • (21)
  • (50)
  • (7)
  • (32)
  • (387)
  • (140)
  • (168)
  • (9)
  • (19)
  • (2)
  • (68)
  • (149)
  • (723)
  • (276)
  • (17)
  • (67)
  • (3,539)
  • (34)
  • (2)
  • (162,140)
  • (1,854)
  • (1)
  • (2)
  • (100)
  • (8)
  • (16)
  • (1,620)
  • (24)
  • (2)
  • (93)
  • (29)
  • (35)
  • (13)
  • (34)
  • (5,183)
  • (24)
  • (210)
  • (218)
  • (169)
  • (3,730)
  • (41)
  • (131)
  • (2,695)
  • (164)
  • (112,500)
  • (2,090)
  • (101)
  • (38)
  • (20)
  • (5)
  • (100)
  • (24)
  • (4)
  • (448)
  • (486)
  • (987)
  • (76)
  • (2)
  • (8)
  • (3)
  • (31)
  • (522)
  • (12)
  • (2)
  • (994)
  • (6,912)
  • (36)
  • (79)
  • (513)
  • (422)
  • (701)

Classificazione

  • (232,776)
  • (225,410)

Coniugato

  • (12,138)
  • (7)
  • (1,559)
  • (2)
  • (8)
  • (10,829)
  • (11,157)
  • (11,238)
  • (12,108)
  • (10,815)
  • (11,243)
  • (11,161)
  • (10,807)
  • (6)
  • (91)
  • (2)
  • (1)
  • (2)
  • (2)
  • (1)
  • (1)
  • (3)
  • (13,088)
  • (10,209)
  • (4)
  • (2)
  • (1)
  • (1)
  • (12,735)
  • (12,670)
  • (12,470)
  • (11)
  • (12,736)
  • (16,918)
  • (8)
  • (11)
  • (12,770)
  • (13,066)
  • (13,105)
  • (9)
  • (12,531)
  • (5)
  • (13,199)
  • (1)
  • (2)
  • (5,312)
  • (14,487)
  • (1,696)
  • (1,695)
  • (14,481)
  • (5,284)
  • (1)
  • (12,072)
  • (1,560)
  • (1,565)
  • (1,557)
  • (2)
  • (4)
  • (5)
  • (14,029)
  • (2)
  • (8)
  • (6)
  • (11)
  • (4)
  • (15)
  • (9)
  • (83,788)
  • (114)
  • (13,912)
  • (13,839)
  • (13,860)

Quantità

  • (1)
  • (1)
  • (3,047)
  • (111)
  • (1,813)
  • (2,143)
  • (1)
  • (1)
  • (4)
  • (502)
  • (2,887)
  • (350,221)
  • (9,610)
  • (8)
  • (346)
  • (23)
  • (6)
  • (1)
  • (2,444)
  • (303)
  • (611)
  • (42)
  • (1)
  • (2)
  • (1)
  • (4,863)
  • (248)
  • (1)
  • (3)
  • (2)
  • (7)
  • (24)
  • (1)
  • (1,749)
  • (1,185)
  • (2)
  • (4)
  • (1)
  • (17)
  • (1)
  • (30)
  • (3)
  • (82)
  • (5,882)
  • (36,687)
  • (6)
  • (1)
  • (1)
  • (7)
  • (4)
  • (1)
  • (1)
  • (4)
  • (1)
  • (1)
  • (3)
  • (1)
  • (1)
  • (1)
  • (9)
  • (83)
  • (2,089)
  • (1,324)
  • (4)
  • (64)
  • (3)
  • (30)
  • (1)
  • (16,798)
  • (742)
  • (1)
  • (7)
  • (10)
  • (21)
  • (1)
  • (2,135)
  • (2)
  • (198)
  • (1)
  • (4)
  • (1)
  • (1)
  • (4)
  • (7)
  • (525)
  • (6)
  • (1)
  • (4)
  • (725)
  • (6,649)
  • (2)
  • (2)
  • (7)
  • (14)
  • (596)
  • (1)
  • (2)
  • (1)
  • (5)
  • (2)
  • (1)
  • (256)
  • (5)
  • (7)

Specie ospite

  • (257)
  • (15)
  • (1,160)
  • (466)
  • (3)
  • (6,550)
  • (9)
  • (24)
  • (176)
  • (7,388)
  • (4)
  • (23)
  • (169,509)
  • (5)
  • (257,743)
  • (13,022)
  • (674)
  • (1)
  • (1)

Status giuridico

  • (456,261)

Isotype

  • (39)
  • (13)
  • (1)
  • (11)
  • (2)
  • (258,557)
  • (16,464)
  • (194)
  • (65,786)
  • (34,710)
  • (379)
  • (7)
  • (13)
  • (2,363)
  • (122)
  • (1,830)
  • (78)
  • (25,504)
  • (11,064)
  • (224)
  • (1)
  • (22,872)
  • (10,611)
  • (233)
  • (1)
  • (3)
  • (336)
  • (1,386)
  • (25)
  • (839)
  • (675)
  • (5)
  • (906)
  • (59)
  • (7)
  • (181)
  • (55)
  • (5)
  • (890)
  • (17)

Forma

  • (375)
  • (504)
  • (4)
  • (4,028)
  • (433)
  • (99)
  • (427,883)
  • (447)

Da utilizzare con (applicazione)

  • (1,999)
  • (1,796)
  • (7)
  • (1)
  • (16)
  • (305)
  • (19,688)
  • (2)
  • (7)
  • (11)
  • (33)
  • (78)
  • (1)
  • (5)
  • (7)
  • (3)
  • (10)
  • (547)
  • (19,633)
  • (3)
  • (2)
  • (1)
  • (20)
  • (21)
  • (40)
  • (236)
  • (564)
  • (9)
  • (323)
  • (7)
  • (57)
  • (62)
  • (17)
  • (68)
  • (1)
  • (11)
  • (4,194)
  • (2)
  • (19,541)
  • (6)
  • (2,337)
  • (4)
  • (2)
  • (2)
  • (19,707)
  • (5)
  • (1)

1 – 15 di 608,065 risultati
2

GAD2/GAD65 Antibody (U.Washington patent anti-GAD65), Novus Biologicals™

Human Monoclonal Antibody

ID gene (immissione) 2572
Specie ospite Human
Content And Storage Store at -20°C in powder form. Store at -80°C once reconstituted.
Immunogeno GAD65
N. accesso geni Q05329
Target Species Human
Applicazioni Flow Cytometry,ELISA,Functional Assay
Coniugato Unconjugated
Classificazione Monoclonal
Alias gene EC 4.1.1, EC 4.1.1.15, GAD-65, GAD65MGC161605, glutamate decarboxylase 2, glutamate decarboxylase 2 (pancreatic islets and brain, 65kD), glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa), Glutamate decarboxylase 65 kDa isoform, Glutamate decarboxylase-2 (pancreas), MGC161607,65 kDa glutamic acid decarboxylase
Isotype IgG1
Ricostituzione Reconstitute with sterile, distilled water to a final concentration of 1 mg/mL. Gently shake to solubilize completely. Do not vortex.
Forma Purified
Antigene GAD2/GAD65
Metodo di purificazione Protein A purified
Status giuridico RUO
Formulazione Lyophilized from 25mM histidine, 8% sucrose, 0.01% Tween80 (pH6.2)
Disciplina di ricerca Diabetes Research, Immune System Diseases, Immunology, Lipid and Metabolism, Neuronal Cell Markers, Neuroscience
Primario o secondario Primary
Clone U.Washington patent anti-GAD65
3

Factor VIII Antibody - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 4 publications

Specie ospite Rabbit
Immunogeno A synthetic peptide made to a C-terminal portion of human Factor VIII (between amino acids 2100-2250) [UniProt P00451]
Target Species Mouse,Rat
Applicazioni Western Blot,Immunofluorescence,Immunohistochemistry (Paraffin)
Antigene Factor VIII
Metodo di purificazione Affinity Purified
Simboli geni F8
Status giuridico RUO
4

NPLOC4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications

ID gene (immissione) 55666
Specie ospite Rabbit
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Immunogeno This antibody was developed against Recombinant Protein corresponding to amino acids:VRDECLLPCKDAPELGYAKESSSEQYVPDVFYKDVDKFGNEITQLARPLPVEYLIIDITTTFPKDPVYTFSISQNPFPIENRDVLGETQDFHSLATYLSQNTSSVFLDTISDFHLLLFLVTNE
Target Species Human,Mouse,Rat
Applicazioni Western Blot,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin)
Coniugato Unconjugated
Classificazione Polyclonal
Alias gene FLJ20657, FLJ23742, KIAA1499nuclear protein localization protein 4 homolog, NPL4Protein NPL4, nuclear protein localization 4 homolog (S. cerevisiae)
Isotype IgG
Test di specificità Specificity of human NPLOC4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Antigene NPLOC4
Metodo di purificazione Affinity Purified
Simboli geni NPLOC4
Status giuridico RUO
Formulazione PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Primario o secondario Primary
5

PGC1 alpha Antibody - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 156 publications

ID gene (immissione) 10891
Specie ospite Rabbit
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Immunogeno This PGC1 alpha Antibody was developed against a recombinant protein made to an internal portion of the human PGC-1 alpha protein (within residues 400-550). [Swiss-Prot# Q9UBK2].
N. accesso geni Q9UBK2
Target Species Human,Mouse,Rat,Pig,Goat,Hamster,Sheep,Squirrel
Applicazioni Western Blot,ChIP Assay,Flow Cytometry,Immunohistochemistry,Immunocytochemistry,Immunoprecipitation
Coniugato Unconjugated
Peso molecolare dell'antigene 91 kDa
Classificazione Polyclonal
Alias gene LEM6, Ligand effect modulator 6, ligand effect modulator-6, L-PGC-1alpha, peroxisome proliferative activated receptor, gamma, coactivator 1, alpha, peroxisome proliferator-activated receptor gamma coactivator 1 alpha transcript variant B4-3ext, peroxisome proliferator-activated receptor gamma coactivator 1 alpha transcript variant B4-8a, peroxisome proliferator-activated receptor gamma coactivator 1 alpha transcript variant B5-NT, peroxisome proliferator-activated receptor gamma coactivator 1-alpha, peroxisome proliferator-activated receptor gamma, coactivator 1 alpha, PGC1, PGC-1(alpha), PGC1A, PGC-1-alpha, PGC1APGC-1(alpha), PGC1peroxisome proliferative activated receptor, gamma, coactivator 1, PGC-1v, PPAR gamma coactivator variant form, PPAR gamma coactivator-1, PPARgamma coactivator 1alpha, PPAR-gamma coactivator 1-alpha, PPARGC1, PPARGC-1-alpha
Isotype IgG
Test di specificità Human and Mouse. Squirrel reactivity reported in the scientific literature. Expected reactivity based on sequence identity: monkey (98%), equine (94%), canine (93%) and rat (88%). Rat reactivity reported in scientific literature (PMID: 22208735).
Antigene PGC1 alpha
Metodo di purificazione Affinity Purified
Simboli geni PPARGC1A
Status giuridico RUO
Formulazione PBS with 0.02% Sodium Azide
Disciplina di ricerca Cancer, Cholesterol Metabolism, Chromatin Research, Diabetes Research, Lipid and Metabolism, mTOR Pathway, Neuroscience, Transcription Factors and Regulators
Diluizione Western Blot 1 - 2 ug/ml, Chromatin Immunoprecipitation reported by customer review, Flow Cytometry 1 - 2.5 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1:1000. Use reported in scientific literature (PMID 24508229), Immunoprecipitation reported in scientific literature (PMID 24769256), Immunohistochemistry-Paraffin 1:200, Immunohistochemistry-Frozen reported in scientific literature (PMID 25981953), Flow (Intracellular) 1 - 2.5 ug/ml, Chromatin Immunoprecipitation (ChIP), Knockout Validated, KnockDown Validated reported in scientific literature (PMID 35455432)
Concentrazione 1.0 mg/mL
Primario o secondario Primary
10

alpha-Synuclein Antibody (prasinezumab) - Humanized, Novus Biologicals™

Human Monoclonal Antibody

ID gene (immissione) 6622
Specie ospite Human
Content And Storage Store at -20°C in powder form. Store at -80°C once reconstituted.
Immunogeno Alpha-synuclein
N. accesso geni Q9Y6H5
Target Species Human
Applicazioni Flow Cytometry,ELISA,Functional Assay
Coniugato Unconjugated
Classificazione Monoclonal
Alias gene alpha-synuclein, I+/--synuclein, MGC110988, NACP, non A-beta component of AD amyloid, Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor, PARK1, PARK4, PD1, SNCA, synuclein alpha-140, synuclein, alpha (non A4 component of amyloid precursor), truncated alpha synuclein
Isotype IgG1
Ricostituzione Reconstitute with sterile, distilled water to a final concentration of 1 mg/mL. Gently shake to solubilize completely. Do not vortex.
Forma Purified
Antigene alpha-Synuclein
Metodo di purificazione Protein A purified
Status giuridico RUO
Formulazione Lyophilized from 25mM histidine, 8% sucrose, 0.01% Tween80 (pH6.2)
Disciplina di ricerca Alzheimers Research, Apoptosis, Cell Biology, Cellular Markers, Neurodegeneration, Neuroscience
Primario o secondario Primary
Clone prasinezumab
13

Tyrosine Hydroxylase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 147 publications

14

Advillin Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

ID gene (immissione) 10677
Specie ospite Rabbit
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Immunogeno Recombinant fusion protein containing a sequence corresponding to amino acids 470-819 of human AVIL (NP_006567.3). AAVQVRVRMGTEPRHFMAIFKGKLVIFEGGTSRKGNAEPDPPVRLFQIHGNDKSNTKAVEVPAFASSLNSNDVFLLRTQAEHYLWYGKGSSGDERAMAKELASLLCDGSENTVAEGQEPAEFWDLLGGKTPYANDKRLQQEILDVQSRLFECSNKTGQFVVTEITDFTQDDLNPTDVMLLDTWDQVFLWIGAEANATEKESALATAQQYLHTHPSGRDPDTPILIIKQGFEPPIFTGWFLAWDPNIWSAGKTYEQLKEELGDAAAIMRITADMKNATLSLNSNDSEPKYYPIAVLLKNQNQELPEDVNPAKKENYLSEQDFVSVFGITRGQFAALPGWKQLQMKKEKGLF
Target Species Human,Mouse,Rat
Applicazioni Western Blot,Immunofluorescence
Coniugato Unconjugated
Classificazione Polyclonal
Alias gene ADVIL, advillin, DOC6, FLJ12386, MGC133244, p92DKFZp779O1812
Isotype IgG
Forma Purified
Antigene Advillin
Metodo di purificazione Affinity purified
Status giuridico RUO
Formulazione PBS with 50% glycerol, pH7.3.
Disciplina di ricerca Neuroscience
Diluizione Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200
Primario o secondario Primary

Bio Techne