Résultats de la recherche filtrée
Les produits de certains de nos fournisseurs ne s'affichent pas dans les résultats de la recherche filtrée. Veuillez
supprimer tous les filtres
pour voir ces produits.
1
–
15
de
532,272
résultats

Novus Biologicals NPLOC4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
Applications | Western Blot,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin) |
---|---|
Spécificité du test | Specificity of human NPLOC4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Isotype | IgG |
Conjugué | Unconjugated |
Espèces cibles | Human,Mouse,Rat |
Primaire ou secondaire | Primary |
Contenu et stockage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
État réglementaire | RUO |
Immunogène | This antibody was developed against Recombinant Protein corresponding to amino acids:VRDECLLPCKDAPELGYAKESSSEQYVPDVFYKDVDKFGNEITQLARPLPVEYLIIDITTTFPKDPVYTFSISQNPFPIENRDVLGETQDFHSLATYLSQNTSSVFLDTISDFHLLLFLVTNE |
Classification | Polyclonal |
Identification génétique (Entrez) | 55666 |
Méthode de purification | Affinity Purified |
Espèces hôtes | Rabbit |
Symboles de gène(s) | NPLOC4 |
Formule | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
Alias de gène | FLJ20657, FLJ23742, KIAA1499nuclear protein localization protein 4 homolog, NPL4Protein NPL4, nuclear protein localization 4 homolog (S. cerevisiae) |
Antigène | NPLOC4 |
Novus Biologicals Tyrosine Hydroxylase Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 147 publications
Novus Biologicals BATF3 Antibody (841702) [DyLight 405], Novus Biologicals™
Mouse Monoclonal Antibody
Novus Biologicals alpha-Smooth Muscle Actin Antibody (1A4/asm-1), PE, Novus Biologicals™
Mouse Monoclonal Antibody
Novus Biologicals™ NAD-Malate Dehydrogenase/NAD-MDH Activity Assay Kit (Colorimetric)
Assay Kit (Colorimetric)
Novus Biologicals BRD4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
Spécificité du test | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
---|---|
Isotype | IgG |
Conjugué | Unconjugated |
Espèces cibles | Human |
Primaire ou secondaire | Primary |
Contenu et stockage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
État réglementaire | RUO |
Dilution | Simple Western 1:60, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000, Chromatin Immunoprecipitation (ChIP) Reported in scientific literature (PMID:25616107). |
Immunogène | This antibody was developed against Recombinant Protein corresponding to amino acids:PQPAKPQQVIQHHHSPRHHKSDPYSTGHLREAPSPLMIHSPQMSQFQSLTHQSPPQQNVQPKKQELRAASVVQPQPLVVVKEEKIHSPIIRSEPFSPSLRPEPPKHPESIKAPVHLPQRPEMKPVDVGRPVIRPPEQNAPPP |
Classification | Polyclonal |
Identification génétique (Entrez) | 23476 |
Méthode de purification | Affinity Purified |
Espèces hôtes | Rabbit |
Symboles de gène(s) | BRD4 |
Formule | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
Alias de gène | bromodomain containing 4, bromodomain-containing 4, CAPchromosome-associated protein, HUNK1bromodomain-containing protein 4, HUNKI, MCAP, Protein HUNK1 |
Antigène | BRD4 |
Novus Biologicals Sphingosine-1-phosphate Antibody (sonepcizumab), PE, Novus Biologicals™
Human Monoclonal Antibody
Novus Biologicals Factor VIII Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 4 publications
État réglementaire | RUO |
---|---|
Immunogène | A synthetic peptide made to a C-terminal portion of human Factor VIII (between amino acids 2100-2250) [UniProt P00451] |
Applications | Western Blot,Immunofluorescence,Immunohistochemistry (Paraffin) |
Méthode de purification | Affinity Purified |
Espèces cibles | Mouse,Rat |
Espèces hôtes | Rabbit |
Symboles de gène(s) | F8 |
Antigène | Factor VIII |
Poids moléculaire | MolecularWeight-theroretical: 19.9 kDa |
---|---|
Protéine | IFN-tau-1 |
Conditions de stockage | Store at -20°C to -70°C as supplied. After reconstitution, store at 2 to 8 C for 1 month and (at -20°C to -70°C for long term storage. Avoid repeated freeze/thaw cycles.) |
Concentration en endotoxines | Less than 0.1 EU/μg of IFN-tau-1 AS determined by LAL method. |
Pureté ou qualité | >97 % pure by SDS-PAGE and HPLC |
Reconstitution | Recommended to centrifuge prior to opening. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL Apportion stock solutions into working aliquots and store (at <-20°C.) |
Identification génétique (Entrez) | 100144750 |
Symbole de gène(s) | TP-1 |
Formule | Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH 7.4. |
Alias de gène | Antiluteolysin, interferon tau-1, TP-1, Trophoblast antiluteolytic protein, Trophoblast protein 1, Trophoblastin |
À utiliser avec (application) | Bioactivity |
Novus Biologicals™ GAD2/GAD65 Antibody (U.Washington patent anti-GAD65), Novus Biologicals™
Human Monoclonal Antibody
Applications | Flow Cytometry,ELISA,Functional Assay |
---|---|
Isotype | IgG1 |
Conjugué | Unconjugated |
Espèces cibles | Human |
Primaire ou secondaire | Primary |
Contenu et stockage | Store at -20°C in powder form. Store at -80°C once reconstituted. |
Forme | Purified |
État réglementaire | RUO |
Numéro d’ordre du gène | Q05329 |
Immunogène | GAD65 |
Classification | Monoclonal |
Reconstitution | Reconstitute with sterile, distilled water to a final concentration of 1 mg/mL. Gently shake to solubilize completely. Do not vortex. |
Identification génétique (Entrez) | 2572 |
Méthode de purification | Protein A purified |
Disciplines de recherche | Diabetes Research, Immune System Diseases, Immunology, Lipid and Metabolism, Neuronal Cell Markers, Neuroscience |
Espèces hôtes | Human |
Formule | Lyophilized from 25mM histidine, 8% sucrose, 0.01% Tween80 (pH6.2) |
Alias de gène | EC 4.1.1, EC 4.1.1.15, GAD-65, GAD65MGC161605, glutamate decarboxylase 2, glutamate decarboxylase 2 (pancreatic islets and brain, 65kD), glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa), Glutamate decarboxylase 65 kDa isoform, Glutamate decarboxylase-2 (pancreas), MGC161607,65 kDa glutamic acid decarboxylase |
Clone | U.Washington patent anti-GAD65 |
Antigène | GAD2/GAD65 |