Gefilterte Suchergebnisse
Produkte von einigen unserer Lieferanten werden in den gefilterten Suchergebnissen nicht angezeigt. Bitte
deaktivieren Sie alle Filter,
um diese Produkte zu sehen.
1
–
15
von
500,022
Ergebnisse

Novus Biologicals Tyrosine Hydroxylase Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 147 publications
Novus Biologicals™ Multi-Species dsRNA ELISA Kit (Colorimetric)
ELISA kits are ideal for the quantification of target antigens in tissue extracts, serum and cell culture.
Spezifität | The dsRNA Detection Kit allows sensitive and selective detection of dsRNA molecules (larger than 30-40 bp), independent of their nucleotide composition and sequence. |
---|---|
Assay-Empfindlichkeit: | 3 ng/ml |
Lagerungsbedingungen | Store at 4°C short term. Store at -20°C long term. Avoid freeze-thaw cycles. |
Zur Verwendung mit (Anwendung) | ELISA |
Synonym | Double-stranded RNA |
Produkttyp | ELISA Kit (Colorimetric) |
Ziel | Multi-Species |
Assay-Bereich | 1 - 300 ng/ml (0.1 - 30 ng/well) |
Novus Biologicals Factor VIII Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 4 publications
Antigen | Factor VIII |
---|---|
Regulatorischer Status | RUO |
Immunogen | A synthetic peptide made to a C-terminal portion of human Factor VIII (between amino acids 2100-2250) [UniProt P00451] |
Zielspezies | Mouse,Rat |
Wirtsspezies | Rabbit |
Gensymbole | F8 |
Reinigungsverfahren | Affinity Purified |
Anwendungen | Western Blot,Immunofluorescence,Immunohistochemistry (Paraffin) |
Novus Biologicals BATF3 Antibody (841702) [DyLight 405], Novus Biologicals™
Mouse Monoclonal Antibody
Lagerungsbedingungen | Store at -20°C to -70°C as supplied. After reconstitution, store at 2°C to 8°C for 1 month and at -20°C to -70°C for long term storage. Avoid repeated freeze-thaw cycles. |
---|---|
Forschungskategorie | Cellular Markers, Chromatin Research, Neuroscience |
Rekonstitution | Recommended to centrifuge prior to opening. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0mg/mL. Apportion stock solutions into working aliquots and store at <-20°C. |
Konzentration | LYOPH |
Zugriffsnummer | P09429, P09429, P09429 |
Protein | HMGB1/HMG-1 |
Reinheits- oder Qualitätsgrad | >95% by SDS-PAGE and HPLC |
Gensymbol | HMGB1 |
Zusammensetzung | Lyophilized from a 0.2 um filtered concentrated solution in PBS, pH 7.4. |
Molekulargewicht | 26 kDa |
Zur Verwendung mit (Anwendung) | PAGE |
Endotoxin-Konzentration | Less than 1 EU/ug of HMGB1/HMG-1 as determined by LAL method. |
Gen-Alias | Amphoterin, high mobility group box 1, High mobility group protein 1, high mobility group protein B1, high-mobility group (nonhistone chromosomal) protein 1, high-mobility group box 1, HMG-1, HMG1DKFZp686A04236, HMG3, SBP-1, Sulfoglucuronyl carbohydrate binding protein |
Gen-ID (Entrez) | 3146 |
Novus Biologicals Npas4 Antibody (S408-79), Novus Biologicals™
Mouse Monoclonal Antibody has been used in 1 publication
Testspezifität | Detects 90kDa. |
---|---|
Klon | S408-79 |
Form | Purified |
Konjugat | Unconjugated |
Isotype | IgG1 |
Gensymbole | NPAS4 |
Konzentration | 1 mg/mL |
Primär oder sekundär | Primary |
Klassifikation | Monoclonal |
Antigen | Npas4 |
Regulatorischer Status | RUO |
Immunogen | Fusion protein amino acids 597-802 (C-terminus) of rat Npas4. |
Zielspezies | Human,Mouse,Rat |
Wirtsspezies | Mouse |
Reinigungsverfahren | Protein G purified |
Verdünnung | Western Blot 1:1000, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:100, Immunohistochemistry-Frozen |
Gen-Alias | BHLHE79, bHLHe79neuronal PAS domain-containing protein 4, Class E basic helix-loop-helix protein 79, Le-PAS, neuronal PAS domain protein 4, Neuronal PAS4, NXFHLH-PAS transcription factor NXF, PASD10PAS domain-containing protein 10 |
Gen-ID (Entrez) | 266743 |
Novus Biologicals IgM Antibody (DA4-4 (same as SA-DA4 or HB57)) - Azide and BSA Free, Novus Biologicals™
Mouse Monoclonal Antibody
Novus Biologicals ST2/IL-33R Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Testspezifität | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
---|---|
Konjugat | Unconjugated |
Isotype | IgG |
Gensymbole | IL1RL1 |
Primär oder sekundär | Primary |
Inhalt und Lagerung | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Zusammensetzung | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
Klassifikation | Polyclonal |
Antigen | ST2/IL-33R |
Regulatorischer Status | RUO |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:PDVLENKCGYTLCIYGRDMLPGEDVVTAVETNIRKSRRHIFILTPQITHNKEFAYEQEVALHCALIQNDAKVILIEMEALSELDMLQAEALQDSLQHLMKVQGTIKWREDHIANKRSLNSKFWKHVRYQMPVPSKIPRKASSLTPL |
Zielspezies | Human |
Forschungsgebiet | Angiogenesis |
Wirtsspezies | Rabbit |
Reinigungsverfahren | Affinity Purified |
Anwendungen | Western Blot,Immunohistochemistry,Immunohistochemistry (Paraffin) |
Verdünnung | Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:200-1:500 |
Gen-Alias | DER4ST2growth stimulation-expressed, FIT-1, IL33R, interleukin 1 receptor-like 1, interleukin 1 receptor-related protein, interleukin-1 receptor-like 1, MGC32623, Protein ST2, ST2L, ST2V, T1homolog of mouse growth stimulation-expressed |
Gen-ID (Entrez) | 9173 |
Novus Biologicals PIEZO1 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 16 publications
Novus Biologicals N-Cadherin Antibody (13A9), Novus Biologicals™
Mouse Monoclonal Antibody has been used in 35 publications
Klon | 13A9 |
---|---|
Form | Purified |
Gen-Zugriffsnummer | P19022 |
Konjugat | Unconjugated |
Isotype | IgG1 |
Gensymbole | CDH2 |
Konzentration | 1 mg/mL |
Primär oder sekundär | Primary |
Molekulargewicht des Antigens | 140 kDa |
Inhalt und Lagerung | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Klassifikation | Monoclonal |
Antigen | N-Cadherin |
Regulatorischer Status | RUO |
Immunogen | This N-Cadherin Antibody (13A9) was developed against the cytoplasmic domain of human N Cadherin [Swiss-Prot# P19022]. |
Zielspezies | Human,Mouse,Rat |
Forschungsgebiet | Cancer, Cell Cycle and Replication, Cellular Markers, Extracellular Matrix, Mesenchymal Stem Cell Markers, Neuroscience, Plasma Membrane Markers, Signal Transduction, Stem Cells |
Wirtsspezies | Mouse |
Reinigungsverfahren | Protein G purified |
Anwendungen | Western Blot,Flow Cytometry,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunoprecipitation,Immunohistochemistry (Paraffin) |
Verdünnung | Western Blot 0.5 ug/ml, Simple Western 1:50, Flow Cytometry, Immunohistochemistry 1:50-1:200, Immunocytochemistry/Immunofluorescence 1:100, Immunoprecipitation 1:10-1:500, Immunohistochemistry-Paraffin 1:50-1:100, Flow (Intracellular), Immunocytochemistry |
Gen-Alias | cadherin 2, N-cadherin (neuronal), cadherin 2, type 1, N-cadherin (neuronal), cadherin-2, CD325, CD325 antigen, CDHNcalcium-dependent adhesion protein, neuronal, CDw325, N-cadherin, NCADN-cadherin 1, Neural cadherin, neural-cadherin |
Gen-ID (Entrez) | 1000 |
Novus Biologicals MBP Antibody (12), Novus Biologicals™
Rat Monoclonal Antibody has been used in 19 publications
Testspezifität | NB600-717 reacts with myelin basic protein from a wide range of species. The antibody reacts weakly with peptides ending in the Phe 91 where the 91-92 Phe-Phe bond is broken. Synthetic peptide 82-99 reacts very well, as does intact MBP. Further epitope analysis indicates binding to a region defined by amino acids 82-87 (DENPVV). Clone 12 has been reported as being suitable for use in Western blotting. |
---|---|
Klon | 12 |
Form | Supernatant |
Gen-Zugriffsnummer | P02687 |
Konjugat | Unconjugated |
Isotype | IgG2a |
Gensymbole | MBP |
Primär oder sekundär | Primary |
Inhalt und Lagerung | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Klassifikation | Monoclonal |
Antigen | MBP |
Regulatorischer Status | RUO |
Immunogen | Bovine MBP |
Zielspezies | Human |
Forschungsgebiet | Neuroscience, Neurotransmission, Oligodendrocyte Cell Markers, Stem Cell Markers |
Wirtsspezies | Rat |
Reinigungsverfahren | Tissue culture supernatant |
Anwendungen | Western Blot |
Verdünnung | Western Blot 1:100-1:2000, ELISA 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500, Immunohistochemistry-Frozen 1:10-1:500, Radioimmunodiffusion |
Gen-Alias | MGC99675, Myelin A1 protein, myelin basic protein, Myelin membrane encephalitogenic protein |
Gen-ID (Entrez) | 4155 |
Form | Purified |
---|---|
Konjugat | Unconjugated |
Isotype | IgG |
Primär oder sekundär | Primary |
Inhalt und Lagerung | Store at -20°C. Avoid freeze-thaw cycles. |
Zusammensetzung | PBS (pH 7.3), 50% glycerol |
Klassifikation | Polyclonal |
Antigen | ETHE1 |
Regulatorischer Status | RUO |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 8-245 of human ETHE1 (NP_055112.2).,, Sequence:, VARRQLSQRGGSGAPILLRQMFEPVSCTFTYLLGDRESREAVLIDPVLETAPRDAQLIKELGLRLLYAVNTHCHADHITGSGLLRSLLPGCQSVISRLSGAQADLHIEDGDSIRFGRFALETRASPGHTPGCVTFVLNDHSMAFTGDALLIRGCGRTDFQQGCAKTLYHSVHEKIFTLPGDCLIYPAHDYHGFTVSTVEEERTLNPRLTLSCEEFVKIMGNLNLPKPQQIDFAVPANM |
Zielspezies | Human,Mouse,Rat |
Forschungsgebiet | metabolism |
Wirtsspezies | Rabbit |
Reinigungsverfahren | Affinity purified |
Anwendungen | ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/Immunofluorescence |
Verdünnung | Western Blot 1:500 - 1:1000, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
Gen-Alias | D83198, EC 3.1.2.6, ethylmalonic encephalopathy 1, Ethylmalonic encephalopathy protein 1, Hepatoma subtracted clone one protein, HSCOEC 3.-, protein ETHE1, mitochondrial, YF13H12 |
Gen-ID (Entrez) | 23474 |