accessibility menu, dialog, popup

UserName
Bio Techne logo

Bio Techne

Bio-Techne ist ein weltweit tätiger Entwickler, Hersteller und Anbieter von hochwertigen Reagenzien, Analyseinstrumenten und Präzisionsdiagnostika. Ganz gleich, ob Sie an der Spitze der akademischen Forschung stehen, grundlegende Entdeckungen in therapeutische Ansätze umsetzen oder in einer Einrichtung arbeiten, die diagnostische Tests auf höchstem Niveau erfordert - unsere preisgekrönten Tools und Lösungen ermöglichen Wissenschaftlern und Klinikern reproduzierbare und konsistente Ergebnisse. Wenn Sie sich für Bio-Techne entscheiden, haben Sie die Gewissheit, dass jede Lösung, die Sie einsetzen, Ihnen zu besseren Antworten verhilft.

Top-Kategorien

Antikörper

Antikörper sind unverzichtbare Werkzeuge für die biomedizinische Forschung, da sie es Forschern ermöglichen, spezifische Proteine oder Moleküle zu identifizieren. Unser Katalog mit mehr als 425.000 Antikörpern unserer Marken R&D Systems™ und Novus Biologicals™ wurde in über 25 Spezies für mehr als 15 Anwendungen auf Spezifität und Reproduzierbarkeit validiert, so dass Sie garantiert einen für Ihren Forschungsbedarf finden werden.

Finden Sie Ihre Antikörper
Antibodies

Zellkulturreagenzien und Assays

Ihre einzigartigen Zellkulturen erfordern eine einheitliche Grundlage, unabhängig davon, ob Sie klassische oder spezielle Medien, Seren, Ergänzungsmittel und Matrizen verwenden. Eine gründliche Zellcharakterisierung ist ebenfalls von entscheidender Bedeutung, um festzustellen, ob der Phänotyp dem entspricht, was Sie für Ihre spezielle Anwendung benötigen.

Finden Sie Ihre Zellkulturreagenzien
Cell Culture Reagents and Assays

ELISA-Kits

Mit den streng validierten und getesteten ELISA-Kits von R&D Systems™ können Sie sich auf Ihre Ergebnisse verlassen. Als der Anbieter mit den meisten Veröffentlichungen von ELISA-Kits und mehr als 30 Jahren Erfahrung in der Entwicklung und Optimierung quantitativer Immunoassays können Sie sich darauf verlassen, dass Sie jedes Mal publizierbare, reproduzierbare Daten erhalten.

Finden Sie Ihre ELISA-Kits
ELISA Kits

Fluoreszierende Farbstoffe und Sonden

Fluoreszierende und biolumineszierende Reagenzien ermöglichen eine hochempfindliche und selektive Visualisierung biologischer Vorgänge, von der Verfolgung einzelner Moleküle in vitro bis hin zur In-vivo-Bildgebung. Entdecken Sie unser exklusives Angebot an Fluoreszenzsonden, Indikatoren, Farbstoffen und Färbemitteln.

Finden Sie Ihre Farbstoffe und Sonden
Fluorescent Dyes and Probes

Rekombinante Proteine

Bio-Techne bietet über 5.000 bioaktive rekombinante Proteine von R&D Systems™ an, die 35 Spezies und mehrere Forschungsbereiche abdecken. Unser Portfolio umfasst Zytokine und Wachstumsfaktoren, Proteine für die Untersuchung immunonkologischer Zielmoleküle, Enzyme, tierversuchsfreie und GMP-konforme Proteine sowie kundenspezifische Proteinentwicklungsdienste und mehr.

Finden Sie Ihre rekombinanten Proteine
Recombinant Proteins

Kleine Moleküle und Peptide

Kleine Moleküle und Peptide können in allen Phasen der biologischen und biomedizinischen Forschung eingesetzt werden. Die einzigartige Sammlung kleiner Moleküle und Peptide von Bio-Techne umfasst hochwertige, neuartige und innovative Verbindungen wie Enzyminhibitoren, Ionenkanalmodulatoren, GPCR-Agonisten und -Antagonisten, fluoreszierende Sonden und Farbstoffe sowie molekularbiologische Werkzeuge.

Finden Sie Ihre kleinen Moleküle
Small Molecules and Peptides

Verwandte Ressourcen

Optimizing Organoid Culture Conditions:

Optimizing Organoid Culture Conditions

Ein Anwendungsbericht, der den Wert von R&D Systems™-Proteinen für robuste, reproduzierbare Organoidkulturbedingungen aufzeigt

Dateiname
23227_bio_techne_optimizing_organoids_Fisherised_v2.pdf
Größe
1 MB
Format
application/pdf
Realize Your Protein and Cell Potential

Realize Your Protein and Cell Potential

Verwirklichen Sie Ihr Protein- und Zellpotenzial

Dateiname
23227_bio_techne_realize_protein_Fisherised.pdf
Größe
3 MB
Format
application/pdf
Organ-on-a-Chip Technology:

Organ-on-a-Chip Technology

Fortschritte, Herausforderungen und eine spannende Zukunft

Dateiname
23227_bio_techne_organ_on_a_chip_technology_progress_Fisherised.pdf
Größe
326 KB
Format
application/pdf

Fisher Scientific Europe kündigt eine neue Vertriebsvereinbarung mit Bio-Techne in Europa an

Paris, Frankreich 01-05-2024

 

Thermo Fisher Scientific, ein führender Anbieter von Laborprodukten und -dienstleistungen, freut sich, einen wichtigen Meilenstein in seinem Engagement für die Bereitstellung von Spitzenlösungen für seine Kunden bekannt zu geben. Mit Wirkung vom 1. Mai 2024 wird Thermo Fisher eine strategische europäische Vertriebsvereinbarung mit Bio-Techne (NASDAQ: TECH) eingehen, einem globalen Life-Science-Unternehmen, das innovative Werkzeuge und bioaktive Reagenzien für die Forschung und die klinische Diagnostik anbietet.

 

Diese Partnerschaft stellt eine wichtige Zusammenarbeit zwischen zwei Branchenführern in den Bereichen wissenschaftliche Forschung, Diagnostik und Biotechnologie dar. Im Rahmen dieser Vereinbarung wird Thermo Fisher über den Fisher Scientific-Vertriebskanal in Europa das umfangreiche Portfolio innovativer Produkte von Bio-Techne, darunter Antikörper, Proteine, Immunoassay-Kits, Reagenzien und Enzyme, an Labors und Forschungseinrichtungen in ganz Europa vertreiben.

 

„Wir freuen uns sehr über die Partnerschaft mit Bio-Techne,einem Unternehmen, das für seine bahnbrechenden Fortschritte in der Life-Science-Branche bekannt ist“, sagte Claire Wallace, President, Fisher Scientific Channel, Europe. „Indem wir die hochwertigen Produkte von Bio-Techne in unser umfassendes Portfolio aufnehmen, wollen wir Wissenschaftlern und Forschern die Werkzeuge an die Hand geben, die sie benötigen, um bahnbrechende Entdeckungen und Fortschritte im Gesundheitswesen zu erzielen.“

 

Die hochmodernen Produkte von Bio-Techne wurden entwickelt, um die Forschung zu beschleunigen und die Ergebnisse in Bereichen wie Zell- und Gentherapie, Immunologie, Neurowissenschaften und mehr zu verbessern. Mit dieser Zusammenarbeit unterstreicht Thermo Fisher sein Engagement, seinen Kunden Zugang zu den neuesten Technologien und Fachkenntnissen zu verschaffen, um letztlich die wissenschaftlichen Erkenntnisse zu erweitern und die menschliche Gesundheit zu verbessern.

 

„Wir freuen uns über die Partnerschaft mit Thermo Fisher, um die Reichweite unserer Produkte und Dienstleistungen in ganz Europa zu erweitern“, sagte Kim Kelderman, Präsident und Chief Executive Officer von Bio-Techne. „Indem wir das umfangreiche europäische Vertriebsnetz und die Branchenexpertise des Fisher Scientific Channel nutzen, wollen wir die Unterstützung für Forscher verbessern und wissenschaftliche Entdeckungen beschleunigen, die sich mit einigen der dringendsten Herausforderungen im Gesundheitswesen befassen.“

 

Diese Vertriebsvereinbarung unterstreicht das Engagement von Thermo Fisher für die Förderung von Innovation und Zusammenarbeit innerhalb der wissenschaftlichen Gemeinschaft. Durch strategische Partnerschaften mit führenden Unternehmen wie Bio-Techne baut Thermo Fisher seine Position als zuverlässiger Partner für Forscher und Labore in ganz Europa weiter aus.

 

Über Bio-Techne

Bio-Techne Corporation (NASDAQ: TECH) ist ein weltweit tätiges Biowissenschaftsunternehmen, das innovative Werkzeuge und bioaktive Reagenzien für die Forschung und die klinische Diagnostik anbietet. Die Produkte von Bio-Techne unterstützen die wissenschaftliche Erforschung biologischer Prozesse sowie der Art und des Verlaufs bestimmter Krankheiten. Sie helfen bei der Entdeckung von Medikamenten und ermöglichen genaue klinische Tests und Diagnosen. Mit Tausenden von Produkten in seinem Portfolio erwirtschaftete Bio-Techne im Geschäftsjahr 2023 einen Nettoumsatz von über 1,1 Milliarden US-Dollar und beschäftigt weltweit rund 3.100 Mitarbeiter.

 

Fragen? Wenden Sie sich an einen Spezialisten >

 

Gefilterte Suchergebnisse

Produkte von einigen unserer Lieferanten werden in den gefilterten Suchergebnissen nicht angezeigt. Bitte deaktivieren Sie alle Filter, um diese Produkte zu sehen.

Ergebnisse verfeinern

Ergebnisse verfeinern

kategorie

spezialprogramme

  • (6,735)

Anwendungen

  • (42)
  • (75)
  • (88)
  • (7)
  • (1)
  • (333)
  • (84)
  • (5)
  • (930)
  • (282)
  • (1,131)
  • (119)
  • (50)
  • (69)
  • (4)
  • (127)
  • (38,447)
  • (1)
  • (36)
  • (59)
  • (93)
  • (1,174)
  • (90)
  • (138,499)
  • (1,806)
  • (1,717)
  • (1,765)
  • (21)
  • (59)
  • (91,033)
  • (290)
  • (7,103)
  • (3)
  • (6)
  • (309)
  • (6,842)
  • (6)
  • (29)
  • (92)
  • (1,182)
  • (56)
  • (67)
  • (6)
  • (36)
  • (910)
  • (618)
  • (38,605)
  • (36,652)
  • (321)
  • (27)
  • (62,019)
  • (144,186)
  • (368)
  • (7,308)
  • (24)
  • (168,663)
  • (18)
  • (48)
  • (22)
  • (278)
  • (23,930)
  • (52)
  • (180)
  • (37)
  • (152)
  • (87)
  • (95)
  • (4,520)
  • (86)
  • (8)
  • (6)
  • (134)
  • (5)
  • (129)
  • (967)
  • (2)
  • (4,195)
  • (18)
  • (223)
  • (92)
  • (6,989)
  • (307)
  • (2)
  • (3)
  • (7)
  • (338)
  • (3)
  • (7)
  • (137)
  • (4,299)
  • (135)
  • (142)
  • (2,628)
  • (75)
  • (1)
  • (22)
  • (100)
  • (11)
  • (239,802)
  • (453)
  • (15)

Klassifikation

  • (227,104)
  • (181,034)

Zielspezies

  • (5)
  • (27)
  • (78)
  • (12)
  • (408)
  • (69)
  • (12)
  • (287)
  • (8)
  • (20)
  • (258)
  • (366)
  • (24)
  • (1,192)
  • (140)
  • (6,585)
  • (341)
  • (629)
  • (172)
  • (2)
  • (6)
  • (5,942)
  • (273)
  • (2,329)
  • (137)
  • (251)
  • (236)
  • (53)
  • (2)
  • (4)
  • (1)
  • (887)
  • (2)
  • (115)
  • (11)
  • (17)
  • (497)
  • (41)
  • (8)
  • (537)
  • (74)
  • (1)
  • (4)
  • (1,641)
  • (39)
  • (1)
  • (1,327)
  • (29)
  • (214)
  • (127)
  • (1)
  • (49)
  • (307)
  • (55)
  • (53)
  • (676)
  • (1)
  • (86)
  • (10)
  • (1,039)
  • (37)
  • (173)
  • (61)
  • (46)
  • (27)
  • (49)
  • (1,016)
  • (109)
  • (367,344)
  • (285)
  • (1)
  • (21)
  • (50)
  • (7)
  • (32)
  • (387)
  • (140)
  • (131)
  • (9)
  • (19)
  • (2)
  • (68)
  • (149)
  • (692)
  • (276)
  • (17)
  • (2)
  • (67)
  • (3,526)
  • (34)
  • (2)
  • (127,924)
  • (1,823)
  • (1)
  • (1)
  • (100)
  • (8)
  • (16)
  • (1,620)
  • (24)
  • (2)
  • (92)
  • (29)
  • (35)
  • (13)
  • (33)
  • (4,313)
  • (26)
  • (210)
  • (917)
  • (169)
  • (3,721)
  • (41)
  • (131)
  • (2,684)
  • (164)
  • (86,366)
  • (2,090)
  • (3)
  • (101)
  • (38)
  • (20)
  • (5)
  • (100)
  • (24)
  • (4)
  • (448)
  • (485)
  • (984)
  • (76)
  • (2)
  • (8)
  • (3)
  • (31)
  • (522)
  • (12)
  • (2)
  • (994)
  • (6,653)
  • (36)
  • (79)
  • (513)
  • (421)
  • (657)

Konjugat

  • (10,545)
  • (7)
  • (1,559)
  • (2)
  • (8)
  • (9,363)
  • (9,698)
  • (9,763)
  • (10,647)
  • (9,347)
  • (9,773)
  • (9,702)
  • (9,369)
  • (3)
  • (91)
  • (3)
  • (2)
  • (1)
  • (2)
  • (2)
  • (1)
  • (1)
  • (3)
  • (11,518)
  • (8,617)
  • (4)
  • (2)
  • (1)
  • (1)
  • (11,126)
  • (11,092)
  • (10,895)
  • (11)
  • (11,141)
  • (15,314)
  • (8)
  • (11)
  • (11,188)
  • (11,461)
  • (11,509)
  • (9)
  • (10,951)
  • (5)
  • (11,575)
  • (1)
  • (2)
  • (3,706)
  • (12,889)
  • (1,696)
  • (1,695)
  • (12,880)
  • (3,708)
  • (1)
  • (10,473)
  • (1,560)
  • (1,565)
  • (1,557)
  • (2)
  • (4)
  • (5)
  • (12,432)
  • (2)
  • (8)
  • (6)
  • (11)
  • (4)
  • (15)
  • (9)
  • (80,556)
  • (114)
  • (12,296)
  • (12,243)
  • (12,272)

Menge

  • (1)
  • (1)
  • (3,047)
  • (111)
  • (1,811)
  • (2,142)
  • (1)
  • (1)
  • (4)
  • (501)
  • (2,886)
  • (303,421)
  • (9,603)
  • (8)
  • (346)
  • (23)
  • (6)
  • (1)
  • (2,444)
  • (295)
  • (611)
  • (42)
  • (1)
  • (2)
  • (1)
  • (4,845)
  • (248)
  • (1)
  • (3)
  • (2)
  • (7)
  • (24)
  • (1)
  • (1,731)
  • (1,185)
  • (2)
  • (4)
  • (1)
  • (17)
  • (1)
  • (30)
  • (3)
  • (82)
  • (5,857)
  • (33,565)
  • (6)
  • (1)
  • (1)
  • (7)
  • (4)
  • (1)
  • (1)
  • (4)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (9)
  • (83)
  • (2,079)
  • (1,318)
  • (4)
  • (64)
  • (3)
  • (30)
  • (1)
  • (16,798)
  • (742)
  • (1)
  • (7)
  • (10)
  • (21)
  • (1)
  • (2,135)
  • (2)
  • (198)
  • (1)
  • (4)
  • (1)
  • (1)
  • (4)
  • (5)
  • (525)
  • (6)
  • (1)
  • (4)
  • (725)
  • (6,649)
  • (2)
  • (2)
  • (7)
  • (14)
  • (596)
  • (1)
  • (2)
  • (1)
  • (5)
  • (1)
  • (1)
  • (256)
  • (5)
  • (7)

Wirtsspezies

  • (257)
  • (15)
  • (1,140)
  • (466)
  • (3)
  • (4,457)
  • (9)
  • (24)
  • (176)
  • (7,388)
  • (4)
  • (23)
  • (164,245)
  • (3)
  • (2)
  • (215,210)
  • (13,022)
  • (570)
  • (1)
  • (1)

Regulatorischer Status

  • (406,239)

Isotype

  • (39)
  • (13)
  • (1)
  • (11)
  • (2)
  • (214,099)
  • (16,179)
  • (194)
  • (62,263)
  • (34,636)
  • (379)
  • (7)
  • (13)
  • (2,363)
  • (122)
  • (1,830)
  • (78)
  • (24,600)
  • (11,020)
  • (224)
  • (1)
  • (22,149)
  • (10,608)
  • (233)
  • (1)
  • (3)
  • (336)
  • (1,386)
  • (25)
  • (836)
  • (675)
  • (5)
  • (906)
  • (59)
  • (7)
  • (181)
  • (55)
  • (5)
  • (868)
  • (17)

Form

  • (373)
  • (501)
  • (4)
  • (4,028)
  • (433)
  • (98)
  • (377,886)
  • (434)

Zur Verwendung mit (Anwendung)

  • (1,997)
  • (1,796)
  • (7)
  • (1)
  • (16)
  • (305)
  • (1)
  • (19,686)
  • (2)
  • (7)
  • (11)
  • (33)
  • (77)
  • (1)
  • (5)
  • (7)
  • (3)
  • (10)
  • (547)
  • (19,633)
  • (3)
  • (2)
  • (1)
  • (20)
  • (21)
  • (40)
  • (236)
  • (564)
  • (9)
  • (323)
  • (7)
  • (57)
  • (62)
  • (17)
  • (68)
  • (1)
  • (11)
  • (4,194)
  • (2)
  • (19,541)
  • (6)
  • (2,337)
  • (4)
  • (2)
  • (2)
  • (19,705)
  • (5)
  • (1)

1 – 15 von 483,650 Ergebnisse
2

Novus Biologicals™ Multi-Species dsRNA ELISA Kit (Colorimetric)

ELISA kits are ideal for the quantification of target antigens in tissue extracts, serum and cell culture.

Spezifität The dsRNA Detection Kit allows sensitive and selective detection of dsRNA molecules (larger than 30-40 bp), independent of their nucleotide composition and sequence.
Assay-Empfindlichkeit: 3 ng/ml
Lagerungsbedingungen Store at 4°C short term. Store at -20°C long term. Avoid freeze-thaw cycles.
Zur Verwendung mit (Anwendung) ELISA
Synonym Double-stranded RNA
Produkttyp ELISA Kit (Colorimetric)
Ziel Multi-Species
Assay-Bereich 1 - 300 ng/ml (0.1 - 30 ng/well)
4

Novus Biologicals Factor VIII Antibody - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 4 publications

Antigen Factor VIII
Regulatorischer Status RUO
Immunogen A synthetic peptide made to a C-terminal portion of human Factor VIII (between amino acids 2100-2250) [UniProt P00451]
Zielspezies Mouse,Rat
Wirtsspezies Rabbit
Gensymbole F8
Reinigungsverfahren Affinity Purified
Anwendungen Western Blot,Immunofluorescence,Immunohistochemistry (Paraffin)
6

Novus Biologicals™ Recombinant Human HMGB1/HMG-1 His (C-Term) Protein

Recombinant Protein

Lagerungsbedingungen Store at -20°C to -70°C as supplied. After reconstitution, store at 2°C to 8°C for 1 month and at -20°C to -70°C for long term storage. Avoid repeated freeze-thaw cycles.
Forschungskategorie Cellular Markers, Chromatin Research, Neuroscience
Rekonstitution Recommended to centrifuge prior to opening. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0mg/mL. Apportion stock solutions into working aliquots and store at <-20°C.
Konzentration LYOPH
Zugriffsnummer P09429, P09429, P09429
Protein HMGB1/HMG-1
Reinheits- oder Qualitätsgrad >95% by SDS-PAGE and HPLC
Gensymbol HMGB1
Zusammensetzung Lyophilized from a 0.2 um filtered concentrated solution in PBS, pH 7.4.
Molekulargewicht 26 kDa
Zur Verwendung mit (Anwendung) PAGE
Endotoxin-Konzentration Less than 1 EU/ug of HMGB1/HMG-1 as determined by LAL method.
Gen-Alias Amphoterin, high mobility group box 1, High mobility group protein 1, high mobility group protein B1, high-mobility group (nonhistone chromosomal) protein 1, high-mobility group box 1, HMG-1, HMG1DKFZp686A04236, HMG3, SBP-1, Sulfoglucuronyl carbohydrate binding protein
Gen-ID (Entrez) 3146
7

Novus Biologicals Npas4 Antibody (S408-79), Novus Biologicals™

Mouse Monoclonal Antibody has been used in 1 publication

Testspezifität Detects 90kDa.
Klon S408-79
Form Purified
Konjugat Unconjugated
Isotype IgG1
Gensymbole NPAS4
Konzentration 1 mg/mL
Primär oder sekundär Primary
Klassifikation Monoclonal
Antigen Npas4
Regulatorischer Status RUO
Immunogen Fusion protein amino acids 597-802 (C-terminus) of rat Npas4.
Zielspezies Human,Mouse,Rat
Wirtsspezies Mouse
Reinigungsverfahren Protein G purified
Verdünnung Western Blot 1:1000, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:100, Immunohistochemistry-Frozen
Gen-Alias BHLHE79, bHLHe79neuronal PAS domain-containing protein 4, Class E basic helix-loop-helix protein 79, Le-PAS, neuronal PAS domain protein 4, Neuronal PAS4, NXFHLH-PAS transcription factor NXF, PASD10PAS domain-containing protein 10
Gen-ID (Entrez) 266743
9

Novus Biologicals ST2/IL-33R Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Testspezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Konjugat Unconjugated
Isotype IgG
Gensymbole IL1RL1
Primär oder sekundär Primary
Inhalt und Lagerung Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Zusammensetzung PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Klassifikation Polyclonal
Antigen ST2/IL-33R
Regulatorischer Status RUO
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PDVLENKCGYTLCIYGRDMLPGEDVVTAVETNIRKSRRHIFILTPQITHNKEFAYEQEVALHCALIQNDAKVILIEMEALSELDMLQAEALQDSLQHLMKVQGTIKWREDHIANKRSLNSKFWKHVRYQMPVPSKIPRKASSLTPL
Zielspezies Human
Forschungsgebiet Angiogenesis
Wirtsspezies Rabbit
Reinigungsverfahren Affinity Purified
Anwendungen Western Blot,Immunohistochemistry,Immunohistochemistry (Paraffin)
Verdünnung Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:200-1:500
Gen-Alias DER4ST2growth stimulation-expressed, FIT-1, IL33R, interleukin 1 receptor-like 1, interleukin 1 receptor-related protein, interleukin-1 receptor-like 1, MGC32623, Protein ST2, ST2L, ST2V, T1homolog of mouse growth stimulation-expressed
Gen-ID (Entrez) 9173
11

Novus Biologicals N-Cadherin Antibody (13A9), Novus Biologicals™

Mouse Monoclonal Antibody has been used in 35 publications

Klon 13A9
Form Purified
Gen-Zugriffsnummer P19022
Konjugat Unconjugated
Isotype IgG1
Gensymbole CDH2
Konzentration 1 mg/mL
Primär oder sekundär Primary
Molekulargewicht des Antigens 140 kDa
Inhalt und Lagerung Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Klassifikation Monoclonal
Antigen N-Cadherin
Regulatorischer Status RUO
Immunogen This N-Cadherin Antibody (13A9) was developed against the cytoplasmic domain of human N Cadherin [Swiss-Prot# P19022].
Zielspezies Human,Mouse,Rat
Forschungsgebiet Cancer, Cell Cycle and Replication, Cellular Markers, Extracellular Matrix, Mesenchymal Stem Cell Markers, Neuroscience, Plasma Membrane Markers, Signal Transduction, Stem Cells
Wirtsspezies Mouse
Reinigungsverfahren Protein G purified
Anwendungen Western Blot,Flow Cytometry,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunoprecipitation,Immunohistochemistry (Paraffin)
Verdünnung Western Blot 0.5 ug/ml, Simple Western 1:50, Flow Cytometry, Immunohistochemistry 1:50-1:200, Immunocytochemistry/Immunofluorescence 1:100, Immunoprecipitation 1:10-1:500, Immunohistochemistry-Paraffin 1:50-1:100, Flow (Intracellular), Immunocytochemistry
Gen-Alias cadherin 2, N-cadherin (neuronal), cadherin 2, type 1, N-cadherin (neuronal), cadherin-2, CD325, CD325 antigen, CDHNcalcium-dependent adhesion protein, neuronal, CDw325, N-cadherin, NCADN-cadherin 1, Neural cadherin, neural-cadherin
Gen-ID (Entrez) 1000
12

Novus Biologicals MBP Antibody (12), Novus Biologicals™

Rat Monoclonal Antibody has been used in 19 publications

Testspezifität NB600-717 reacts with myelin basic protein from a wide range of species. The antibody reacts weakly with peptides ending in the Phe 91 where the 91-92 Phe-Phe bond is broken. Synthetic peptide 82-99 reacts very well, as does intact MBP. Further epitope analysis indicates binding to a region defined by amino acids 82-87 (DENPVV). Clone 12 has been reported as being suitable for use in Western blotting.
Klon 12
Form Supernatant
Gen-Zugriffsnummer P02687
Konjugat Unconjugated
Isotype IgG2a
Gensymbole MBP
Primär oder sekundär Primary
Inhalt und Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Klassifikation Monoclonal
Antigen MBP
Regulatorischer Status RUO
Immunogen Bovine MBP
Zielspezies Human
Forschungsgebiet Neuroscience, Neurotransmission, Oligodendrocyte Cell Markers, Stem Cell Markers
Wirtsspezies Rat
Reinigungsverfahren Tissue culture supernatant
Anwendungen Western Blot
Verdünnung Western Blot 1:100-1:2000, ELISA 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500, Immunohistochemistry-Frozen 1:10-1:500, Radioimmunodiffusion
Gen-Alias MGC99675, Myelin A1 protein, myelin basic protein, Myelin membrane encephalitogenic protein
Gen-ID (Entrez) 4155
13

Novus Biologicals ETHE1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Form Purified
Konjugat Unconjugated
Isotype IgG
Primär oder sekundär Primary
Inhalt und Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Zusammensetzung PBS (pH 7.3), 50% glycerol
Klassifikation Polyclonal
Antigen ETHE1
Regulatorischer Status RUO
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 8-245 of human ETHE1 (NP_055112.2).,, Sequence:, VARRQLSQRGGSGAPILLRQMFEPVSCTFTYLLGDRESREAVLIDPVLETAPRDAQLIKELGLRLLYAVNTHCHADHITGSGLLRSLLPGCQSVISRLSGAQADLHIEDGDSIRFGRFALETRASPGHTPGCVTFVLNDHSMAFTGDALLIRGCGRTDFQQGCAKTLYHSVHEKIFTLPGDCLIYPAHDYHGFTVSTVEEERTLNPRLTLSCEEFVKIMGNLNLPKPQQIDFAVPANM
Zielspezies Human,Mouse,Rat
Forschungsgebiet metabolism
Wirtsspezies Rabbit
Reinigungsverfahren Affinity purified
Anwendungen ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/Immunofluorescence
Verdünnung Western Blot 1:500 - 1:1000, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Gen-Alias D83198, EC 3.1.2.6, ethylmalonic encephalopathy 1, Ethylmalonic encephalopathy protein 1, Hepatoma subtracted clone one protein, HSCOEC 3.-, protein ETHE1, mitochondrial, YF13H12
Gen-ID (Entrez) 23474
14

Novus Biologicals CPT2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Form Purified
Konjugat Unconjugated
Isotype IgG
Primär oder sekundär Primary
Inhalt und Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Zusammensetzung PBS (pH 7.3), 50% glycerol
Klassifikation Polyclonal
Antigen CPT2
Regulatorischer Status RUO
Immunogen A synthetic peptide corresponding to a sequence within amino acids 420-658 of human CPT2 (NP_000089.1).,, Sequence:, VALDKQNKHTSYISGPWFDMYLSARDSVVLNFNPFMAFNPDPKSEYNDQLTRATNMTVSAIRFLKTLRAGLLEPEVFHLNPAKSDTITFKRLIRFVPSSLS
Zielspezies Human,Mouse,Rat
Forschungsgebiet Cancer, Cardiovascular Biology, Endocrinology, Signal Transduction
Wirtsspezies Rabbit
Reinigungsverfahren Affinity purified
Anwendungen ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin)
Verdünnung Western Blot 1:100 - 1:500, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Gen-Alias carnitine O-palmitoyltransferase 2, mitochondrial, carnitine palmitoyltransferase 2, Carnitine palmitoyltransferase IIEC 2.3.1.21, CPT II, CPT1, CPTASE
Gen-ID (Entrez) 1376
15

Novus Biologicals CARS2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Testspezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Konjugat Unconjugated
Isotype IgG
Gensymbole CARS2
Primär oder sekundär Primary
Inhalt und Lagerung Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Zusammensetzung PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Klassifikation Polyclonal
Antigen CARS2
Regulatorischer Status RUO
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: VFGAIISYFEQFFETVGISLANQQYVSGDGSEATLHGVVDELVRFRQKVRQFALAMPEATGDARRQQLLERQPLLEACDTLRRGLTAHGINIKDRSSTTSTWELLDQR
Zielspezies Human
Wirtsspezies Rabbit
Reinigungsverfahren Affinity Purified
Anwendungen Western Blot,Immunocytochemistry,Immunofluorescence,Immunofluorescence,Immunohistochemistry (Paraffin)
Verdünnung Western Blot 0.04-0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Gen-Alias CysRS, Cysteine TRNA Ligase 2, Cysteine TRNA Ligase 2, Mitochondrial (Putative), Cysteine--tRNA ligase, cysteinyl-tRNA synthetase, Cysteinyl-TRNA Synthetase 2, Mitochondrial (Putative), EC 6.1.1, EC 6.1.1.16, Mitochondrial (Putative), Probable Cysteine--TRNA Ligase, Mitochondrial, Probable Cysteinyl-TRNA Synthetase, Mitochondrial
Gen-ID (Entrez) 79587

Bio Techne