accessibility menu, dialog, popup

UserName
Bio Techne logo

Bio Techne

Bio-Techne is a global developer, manufacturer, and supplier of high-quality reagents, analytical instruments, and precision diagnostics. Whether you’re at the cutting edge of academic research, translating basic discoveries into therapeutic leads, or at a facility that requires the highest level of diagnostic testing, our award-winning tools and solutions empower scientists and clinicians to achieve reproducible and consistent results. Choosing Bio‑Techne means having confidence that every solution you use will help move you towards better answers.

Top Categories

Antibodies

Antibodies are essential tools for biomedical research as they allow researchers to identify specific proteins or molecules. Our catalog of over 425,000 antibodies from our R&D Systems™ and Novus Biologicals™ brands have been validated for specificity and reproducibility in over 25 species for more than 15 applications, ensuring that you will find one for your research needs.

Find Your Antibodies
Antibodies

Cell Culture Reagents and Assays

Your unique cell cultures require a consistent foundation whether you are using classical or specialty media, sera, supplements, and matrices. Thorough cell characterization is also critical to determine if the phenotype is what you need for your particular application.

Find Your Cell Culture Reagents
Cell Culture Reagents and Assays

ELISA Kits

Have confidence in your results with R&D Systems™ rigorously validated and tested ELISA kits. As the most published ELISA supplier, with more than 30 years of experience designing and optimizing quantitative immunoassays, you can trust that you have publishable, reproducible data every time.

Find Your ELISA Kits
ELISA Kits

Fluorescent Dyes and Probes

Fluorescent and bioluminescent reagents enable highly sensitive and selective visualization of biological events, from single molecule tracking in vitro through to in vivo imaging. Discover our exclusive range of fluorescent probes, indicators, dyes, and stains.

Find Your Dyes and Probes
Fluorescent Dyes and Probes

Recombinant Proteins

Bio-Techne offers over 5,000 R&D Systems™ bioactive recombinant proteins spanning 35 species and multiple research areas. Our portfolio includes cytokines and growth factors, proteins for studying immuno-oncology targets, enzymes, and animal-free and GMP-grade proteins, as well as custom protein development services and more.

Find Your Recombinant Proteins
Recombinant Proteins

Small Molecules and Peptides

Small molecules and peptides can be used in all stages of biological and biomedical research. Bio-Techne’s unique collection of small molecules and peptides includes high quality, novel, and innovative compounds such as enzyme inhibitors, ion channel modulators, GPCR agonists and antagonists, fluorescent probes and dyes, and molecular biology tools.

Find Your Small Molecules
Small Molecules and Peptides

Related Resources

Optimizing Organoid Culture Conditions:

Optimizing Organoid Culture Conditions

An application note demonstrating the value of R&D Systems™ proteins for achieving robust, reproducible organoid culture conditions
Filename
23227_bio_techne_optimizing_organoids_Fisherised_v2.pdf
Size
1 MB
Format
application/pdf
Realize Your Protein and Cell Potential

Realize Your Protein and Cell Potential

Realize your protein and cell potential
Filename
23227_bio_techne_realize_protein_Fisherised.pdf
Size
3 MB
Format
application/pdf
Organ-on-a-Chip Technology:

Organ-on-a-Chip Technology

Progress, challenges, and an exciting future
Filename
23227_bio_techne_organ_on_a_chip_technology_progress_Fisherised.pdf
Size
326 KB
Format
application/pdf

Fisher Scientific Europe Announces a New Distribution Agreement with Bio-Techne in Europe

Paris, France 01-05-2024

 

Thermo Fisher Scientific, a leading provider of laboratory products and services, is pleased to announce a significant milestone in its commitment to providing cutting-edge solutions to its customers. Effective May 1, 2024, Thermo Fisher will enter into a strategic European distribution agreement with Bio-Techne (NASDAQ: TECH), a global life sciences company providing innovative tools and bioactive reagents for the research and clinical diagnostic communities.

This partnership marks an important collaboration between two industry leaders in the fields of scientific research, diagnostics, and biotechnology. Under this agreement, Thermo Fisher, through the Fisher Scientific channel, Europe, will distribute Bio-Techne's extensive portfolio of innovative products, including antibodies, proteins, immunoassay kits, reagents and enzymes to laboratories and research institutions across Europe.

"We are thrilled to forge this partnership with Bio-Techne, a company renowned for its pioneering advancements in the life sciences industry," said Claire Wallace, President, Fisher Scientific channel, Europe. "By adding Bio-Techne's high-quality products to our comprehensive portfolio, we aim to further empower scientists and researchers with the tools they need to drive breakthrough discoveries and advancements in healthcare."

Bio-Techne's state-of-the-art products are designed to accelerate research and improve outcomes in areas including cell and gene therapy, immunology, neuroscience, and more. With this collaboration, Thermo Fisher reinforces its commitment to providing customers with access to the latest technologies and expertise, ultimately advancing scientific knowledge and improving human health.

"We are excited to partner with Thermo Fisher to expand the reach of our products and services throughout Europe," said Kim Kelderman, Bio-Techne’s President and Chief Executive Officer. "By leveraging the Fisher Scientific Channel's extensive European distribution network and industry expertise, we aim to enhance support for researchers and accelerate scientific discoveries that address some of the most pressing challenges in healthcare today."

This distribution agreement underscores Thermo Fisher's dedication to fostering innovation and collaboration within the scientific community. Through strategic partnerships with leading companies like Bio-Techne, Thermo Fisher continues to strengthen its position as a trusted partner for researchers and laboratories across Europe.

About Bio-Techne

Bio-Techne Corporation (NASDAQ: TECH) is a global life sciences company providing innovative tools and bioactive reagents for the research and clinical diagnostic communities. Bio-Techne products assist scientific investigations into biological processes and the nature and progress of specific diseases. They aid in drug discovery efforts and provide the means for accurate clinical tests and diagnoses. With thousands of products in its portfolio, Bio-Techne generated over $1.1 billion in net sales in fiscal year 2023 and has approximately 3,100 employees worldwide.

 

Questions? Reach Out to a Specialist >

 

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Narrow Results

category

special programs

  • (6,875)

Applications

  • (42)
  • (75)
  • (88)
  • (7)
  • (1)
  • (333)
  • (84)
  • (5)
  • (930)
  • (280)
  • (1,131)
  • (121)
  • (50)
  • (69)
  • (4)
  • (127)
  • (38,436)
  • (1)
  • (36)
  • (59)
  • (93)
  • (1,174)
  • (87)
  • (138,514)
  • (1,806)
  • (1,717)
  • (1,765)
  • (21)
  • (59)
  • (91,082)
  • (290)
  • (7,103)
  • (3)
  • (6)
  • (309)
  • (6,842)
  • (6)
  • (29)
  • (92)
  • (1,176)
  • (56)
  • (67)
  • (6)
  • (36)
  • (916)
  • (625)
  • (38,627)
  • (36,654)
  • (321)
  • (27)
  • (62,045)
  • (144,226)
  • (369)
  • (7,319)
  • (24)
  • (168,722)
  • (18)
  • (48)
  • (22)
  • (278)
  • (23,936)
  • (52)
  • (181)
  • (42)
  • (152)
  • (86)
  • (95)
  • (4,528)
  • (86)
  • (8)
  • (6)
  • (134)
  • (5)
  • (129)
  • (967)
  • (2)
  • (4,195)
  • (18)
  • (223)
  • (92)
  • (6,989)
  • (307)
  • (2)
  • (3)
  • (7)
  • (338)
  • (3)
  • (7)
  • (137)
  • (4,299)
  • (135)
  • (142)
  • (2,628)
  • (75)
  • (1)
  • (22)
  • (100)
  • (11)
  • (239,860)
  • (453)
  • (15)

Target Species

  • (5)
  • (27)
  • (78)
  • (12)
  • (409)
  • (70)
  • (12)
  • (288)
  • (8)
  • (20)
  • (258)
  • (366)
  • (24)
  • (1,194)
  • (140)
  • (6,603)
  • (341)
  • (629)
  • (173)
  • (2)
  • (6)
  • (5,950)
  • (273)
  • (2,333)
  • (137)
  • (251)
  • (236)
  • (53)
  • (2)
  • (4)
  • (1)
  • (887)
  • (2)
  • (115)
  • (11)
  • (17)
  • (500)
  • (41)
  • (8)
  • (537)
  • (74)
  • (1)
  • (4)
  • (1,649)
  • (39)
  • (1)
  • (1,328)
  • (29)
  • (215)
  • (127)
  • (1)
  • (49)
  • (308)
  • (55)
  • (53)
  • (676)
  • (1)
  • (88)
  • (10)
  • (1,046)
  • (38)
  • (173)
  • (61)
  • (46)
  • (27)
  • (49)
  • (1,019)
  • (109)
  • (367,435)
  • (285)
  • (1)
  • (21)
  • (50)
  • (7)
  • (32)
  • (387)
  • (140)
  • (136)
  • (9)
  • (19)
  • (2)
  • (68)
  • (149)
  • (692)
  • (276)
  • (17)
  • (67)
  • (3,529)
  • (34)
  • (2)
  • (127,973)
  • (1,823)
  • (1)
  • (2)
  • (100)
  • (8)
  • (16)
  • (1,620)
  • (24)
  • (2)
  • (93)
  • (29)
  • (35)
  • (13)
  • (34)
  • (5,182)
  • (24)
  • (210)
  • (218)
  • (169)
  • (3,730)
  • (41)
  • (131)
  • (2,694)
  • (164)
  • (86,402)
  • (2,090)
  • (101)
  • (38)
  • (20)
  • (5)
  • (100)
  • (24)
  • (4)
  • (448)
  • (485)
  • (987)
  • (76)
  • (2)
  • (8)
  • (3)
  • (31)
  • (522)
  • (12)
  • (2)
  • (994)
  • (6,653)
  • (36)
  • (79)
  • (513)
  • (422)
  • (664)

Classification

  • (227,165)
  • (181,075)

Conjugate

  • (10,546)
  • (7)
  • (1,559)
  • (2)
  • (8)
  • (9,364)
  • (9,699)
  • (9,764)
  • (10,649)
  • (9,348)
  • (9,774)
  • (9,703)
  • (9,369)
  • (6)
  • (91)
  • (2)
  • (1)
  • (2)
  • (2)
  • (1)
  • (1)
  • (3)
  • (11,520)
  • (8,618)
  • (4)
  • (2)
  • (1)
  • (1)
  • (11,127)
  • (11,093)
  • (10,895)
  • (11)
  • (11,144)
  • (15,315)
  • (8)
  • (11)
  • (11,189)
  • (11,461)
  • (11,510)
  • (9)
  • (10,952)
  • (5)
  • (11,576)
  • (1)
  • (2)
  • (3,707)
  • (12,891)
  • (1,696)
  • (1,695)
  • (12,881)
  • (3,709)
  • (1)
  • (10,474)
  • (1,560)
  • (1,565)
  • (1,557)
  • (2)
  • (4)
  • (5)
  • (12,433)
  • (2)
  • (8)
  • (6)
  • (11)
  • (4)
  • (15)
  • (9)
  • (80,583)
  • (114)
  • (12,298)
  • (12,244)
  • (12,273)

Quantity

  • (1)
  • (1)
  • (3,047)
  • (111)
  • (1,816)
  • (2,144)
  • (1)
  • (1)
  • (4)
  • (508)
  • (2,887)
  • (303,460)
  • (9,607)
  • (8)
  • (346)
  • (23)
  • (6)
  • (1)
  • (2,444)
  • (295)
  • (611)
  • (42)
  • (1)
  • (2)
  • (1)
  • (4,845)
  • (248)
  • (1)
  • (3)
  • (2)
  • (7)
  • (24)
  • (1)
  • (1,731)
  • (1,185)
  • (2)
  • (4)
  • (1)
  • (17)
  • (1)
  • (30)
  • (3)
  • (82)
  • (5,868)
  • (33,569)
  • (6)
  • (1)
  • (1)
  • (7)
  • (4)
  • (1)
  • (1)
  • (4)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (9)
  • (83)
  • (2,079)
  • (1,318)
  • (4)
  • (64)
  • (3)
  • (30)
  • (1)
  • (16,798)
  • (743)
  • (1)
  • (7)
  • (10)
  • (21)
  • (1)
  • (2,135)
  • (2)
  • (198)
  • (1)
  • (4)
  • (1)
  • (1)
  • (4)
  • (5)
  • (525)
  • (6)
  • (1)
  • (4)
  • (725)
  • (6,651)
  • (2)
  • (2)
  • (7)
  • (14)
  • (596)
  • (1)
  • (2)
  • (1)
  • (5)
  • (1)
  • (1)
  • (256)
  • (5)
  • (7)

Host Species

  • (257)
  • (15)
  • (1,140)
  • (466)
  • (3)
  • (4,458)
  • (9)
  • (24)
  • (176)
  • (7,388)
  • (4)
  • (23)
  • (164,278)
  • (5)
  • (215,247)
  • (13,021)
  • (570)
  • (1)
  • (1)

Regulatory Status

  • (406,313)

Isotype

  • (39)
  • (13)
  • (1)
  • (11)
  • (2)
  • (214,155)
  • (16,180)
  • (194)
  • (62,267)
  • (34,669)
  • (379)
  • (7)
  • (13)
  • (2,363)
  • (122)
  • (1,830)
  • (78)
  • (24,600)
  • (11,022)
  • (224)
  • (1)
  • (22,148)
  • (10,608)
  • (233)
  • (1)
  • (3)
  • (336)
  • (1,386)
  • (25)
  • (836)
  • (675)
  • (5)
  • (906)
  • (59)
  • (7)
  • (182)
  • (55)
  • (5)
  • (870)
  • (17)

Form

  • (376)
  • (505)
  • (4)
  • (4,028)
  • (433)
  • (99)
  • (377,941)
  • (434)

For Use With (Application)

  • (1,997)
  • (1,796)
  • (7)
  • (1)
  • (16)
  • (305)
  • (19,686)
  • (2)
  • (7)
  • (11)
  • (33)
  • (78)
  • (1)
  • (5)
  • (7)
  • (3)
  • (10)
  • (547)
  • (19,633)
  • (3)
  • (2)
  • (1)
  • (20)
  • (21)
  • (40)
  • (236)
  • (564)
  • (9)
  • (323)
  • (7)
  • (57)
  • (62)
  • (17)
  • (68)
  • (1)
  • (11)
  • (4,194)
  • (2)
  • (19,541)
  • (6)
  • (2,337)
  • (4)
  • (2)
  • (2)
  • (19,705)
  • (5)
  • (1)

1 – 15 of 574,190 results
1

Novus Biologicals NPLOC4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications

Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Target Species Human,Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin)
Isotype IgG
Antigen NPLOC4
Gene Symbols NPLOC4
Regulatory Status RUO
Purification Method Affinity Purified
Gene Alias FLJ20657, FLJ23742, KIAA1499nuclear protein localization protein 4 homolog, NPL4Protein NPL4, nuclear protein localization 4 homolog (S. cerevisiae)
Gene ID (Entrez) 55666
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:VRDECLLPCKDAPELGYAKESSSEQYVPDVFYKDVDKFGNEITQLARPLPVEYLIIDITTTFPKDPVYTFSISQNPFPIENRDVLGETQDFHSLATYLSQNTSSVFLDTISDFHLLLFLVTNE
Classification Polyclonal
Primary or Secondary Primary
Test Specificity Specificity of human NPLOC4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
7

Novus Biologicals EAAT1/GLAST-1/SLC1A3 Antibody - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 18 publications

Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Target Species Human,Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,Flow Cytometry,ELISA,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin)
Isotype IgG
Gene Accession No. P24942
Research Discipline Cellular Markers, Cognition and Behavior
Concentration 1.0 mg/mL
Antigen EAAT1/GLAST-1/SLC1A3
Gene Symbols SLC1A3
Regulatory Status RUO
Purification Method Affinity Purified
Dilution Western Blot 2 μg/mL, Flow Cytometry 1:200-1:500, ELISA 1:100 - 1:2000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1:10-1:500, Immunohistochemistry-Paraffin 1:50-1:500, Immunohistochemistry-Frozen 1:10-1:500, Flow (Intracellular) 1:500
Molecular Weight of Antigen 60 kDa
Gene Alias EA6FLJ25094, EAAT1GLAST-1, excitatory amino acid transporter 1, GLAST, GLASTGLAST1, Sodium-dependent glutamate/aspartate transporter 1, solute carrier family 1 (glial high affinity glutamate transporter), member 3, Solute carrier family 1 member 3
Gene ID (Entrez) 6507
Formulation PBS with 0.02% Sodium Azide
Immunogen A synthetic peptide made to a C-terminal portion of the rat SLC1A3 protein (between residues 500-542) [Uniprot: P24942]
Classification Polyclonal
Primary or Secondary Primary
Test Specificity Human, rat and mouse. Based upon 100% immunogen sequence similarity, this antibody is predicted to cross-react with Bovine also.
8

Novus Biologicals LC3B Antibody - BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 316 publications

Content And Storage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Target Species Human,Mouse,Rat,Pig,Bacteria,Bovine,Canine,Primate,Zebrafish
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,Flow Cytometry,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunoprecipitation,Immunohistochemistry (Paraffin),Immunohistochemistry (Frozen),Immunoblot,Immunoassay,Immunohistochemistry (Free Floating),KnockDown
Isotype IgG
Gene Accession No. Q9GZQ8
Research Discipline Autophagy, Cancer, Cardiovascular Biology, Cellular Markers, Hypoxia, Innate Immunity, Lipid and Metabolism, Macroautophagy, Mitophagy, Neuroscience
Concentration 1.0 mg/mL
Antigen LC3B
Gene Symbols MAP1LC3B
Regulatory Status RUO
Purification Method Affinity Purified
Dilution Western Blot 1:1000, Simple Western 1:100, Flow Cytometry 1:200, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 0.1-2 ug/ml, Immunoprecipitation, Immunohistochemistry-Paraffin 1:200-1:400, Immunohistochemistry-Frozen 1:400, Immunoblotting, Electron Microscopy, Immunohistochemistry Free-Floating, Knockout Validated, Knockdown Validated
Molecular Weight of Antigen 14.688 kDa
Gene Alias ATG8F, Autophagy-related protein LC3 B, Autophagy-related ubiquitin-like modifier LC3 B, LC3B, lc3b autophagy marker, lc3-i, ii, MAP1 light chain 3-like protein 2, MAP1A/1BLC3, MAP1A/MAP1B LC3 B, map1lc3b, MAP1LC3B-a, microtubule associated protein 1 light chain 3 beta, microtubule associated protein 3 b, microtubule associated protein 3 beta, microtubule-associated proteins 1A/1B light chain 3, microtubule-associated proteins 1A/1B light chain 3B
Gene ID (Entrez) 81631
Formulation PBS with 0.02% Sodium Azide
Immunogen Polyclonal LC3B Antibody was made to a synthetic peptide made to the N-terminal region of the human LC3B protein. [Uniprot: Q9GZQ8]
Classification Polyclonal
Primary or Secondary Primary
Test Specificity Human, mouse, rat and bovine. Zebrafish reactivity reported in scientific literature (PMID: 23724125). Canine and primate reactivity reported in scientific literature (PMID: 24027311) Porcine reactivity reported in scientific literature (PMID: 25378587) Other species have not been tested.
14

Novus Biologicals PTPN13/PTPL1 Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Target Species Human,Mouse,Rat
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,Immunofluorescence
Form Purified
Isotype IgG
Research Discipline Protein Phosphatase
Antigen PTPN13/PTPL1
Regulatory Status RUO
Purification Method Affinity purified
Dilution Western Blot 1:2000 - 1:6000, Immunocytochemistry/ Immunofluorescence 1:50-1:100
Gene Alias hPTPE1, PNP1, protein tyrosine phosphatase, non-receptor type 13 (APO-1/CD95 (Fas)-associatedphosphatase), protein-tyrosine phosphatase 1, Fas-associated, PTP1EDKFZp686J1497, PTP-BASEC 3.1.3.48, PTP-E1, PTPL1nonreceptor type 13, tyrosine-protein phosphatase non-receptor type 13
Gene ID (Entrez) 5783
Formulation PBS (pH 7.3), 50% glycerol
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 250-500 of human PTPN13 (NP_542416.1). QDENYFKDILSDNSGREDSENTFSPYQFKTSGPEKKPIPGIDVLSKKKIWASSMDLLCTADRDFSSGETATYRRCHPEAVTVRTSTTPRKKEARYSDGSIALDIFGPQKMDPIYHTRELPTSSAISSALDRIRERQKKLQVLREAMNVEEPVRRYKTYHGDVFSTSSESPSIISSESDFRQVRRSEASKRFESSSGLPGVDETLSQGQSQRPSRQYETPFEGNLINQEIMLKRQEEELMQLQAKMALRQSR
Classification Polyclonal
Primary or Secondary Primary
15

Novus Biologicals Chorein Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 5 publications

Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin)
Isotype IgG
Antigen Chorein
Gene Symbols VPS13A
Regulatory Status RUO
Purification Method Affinity Purified
Gene Alias CHAC, chorea-acanthocytosis protein, vacuolar protein sorting 13 homolog A (S. cerevisiae), vacuolar protein sorting 13A
Gene ID (Entrez) 23230
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RPPRFFNEDGVIRPYRLRDGTGNQMLQVMENGRFAKYKYFTHVMINKTDMLMITRRGVLFVTKGTFGQLTCEWQYSFDEFTKEPFIVHGRRLRIEAKERVKSVF
Classification Polyclonal
Primary or Secondary Primary
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Bio Techne